Results 91 to 100 of about 137,437 (293)
Recent aqueous alteration associated to sedimentary volcanism on Mars
Sedimentary volcanism, whereby material is brought to the surface by fluid overpressure, has been proposed to explain some of the periglacial landforms, including pitted cones, in the Northern Plains of Mars.
M. Pineau +7 more
doaj +1 more source
Cure monitoring of a UV cured epoxy resin using a long period grating Mach- Zehnder interferometer [PDF]
A cascaded long period grating Mach-Zehnder interferometer is used to monitor the change in refractive index of a UV cured epoxy resin over a cure cycle.
Buggy, Stephen J. +3 more
core +1 more source
ABSTRACT This study investigates the relationship between ergonomics and environmental sustainability through a combined bibliometric analysis and scoping review. A search across four major databases identified 1081 articles, of which 82 were included in the final analysis.
Matteo Gremo +4 more
wiley +1 more source
PERANCANGAN ALAT PENDETEKSI KEBOCORAN TABUNG GAS LIQUIEFED PETROLEUM GAS (LPG) BERBASIS MIKROKONTROLER PROYEK AKHIR [PDF]
Sejakdiluncurkannyakebijakanpemerintahdalammengkonversipemakaianminyaktanahkegas LPG (Liquefied Petroleum Gas) telahmengakibatkanmasyarakatberalihuntukmenggunakankomporgas LPGuntukkeperluansehari-hari.Meskipun gas LPG ...
Is Armuna
core
Cooking practices, air quality, and the acceptability of advanced cookstoves in Haryana, India: an exploratory study to inform large-scale interventions. [PDF]
BackgroundIn India, approximately 66% of households rely on dung or woody biomass as fuels for cooking. These fuels are burned under inefficient conditions, leading to household air pollution (HAP) and exposure to smoke containing toxic substances. Large-
Arora, Narendra +10 more
core +2 more sources
Fair Markets and Resilient Supply Chains: Designing Sustainable Intermediation for Rural Communities
ABSTRACT Agriculture in Ecuador's communes faces significant economic, social, and environmental challenges, intensified by supply chains dominated by traditional intermediaries. The lack of context‐specific sustainability studies further increases the vulnerability of smallholders.
Jacqueline del Rocío Bacilio Bejeguen +3 more
wiley +1 more source
On the Effective Configuration of Planning Domain Models [PDF]
The development of domain-independent planners within the AI Planning community is leading to “off the shelf” technology that can be used in a wide range of applications.
Chrpa, Lukáš +3 more
core
Household energy demand and the equity and efficiency aspects of subsidy reform in Indonesia [PDF]
The proper design of price interventions in energy markets requires consideration of equity and efficiency effects. In this paper, budget survey data from 29,000 Indonesian households are used to estimate a demand system for five energy sources, which is
Gibson, John, Olivia, Susan
core +2 more sources
A thermoresponsive complex coacervate is engineered to transport liquid‐core capsules loaded with human adipose‐derived stem cells, forming modular, hierarchically organized tissue‐forming units. This injectable platform enables precise spatial control while maintaining high cell viability, offering a versatile and bioinspired strategy for minimally ...
Luís P. G. Monteiro +5 more
wiley +1 more source
A scalable triazine‐based covalent functionalization strategy of black phosphorus nanosheets provides controlled P‐N surface chemistry with enhanced grafting density in the presence of a phase‐transfer catalyst. As a representative example, BP‐sulfated polymer conjugates exhibit strong in vitro antiviral activity against enveloped viruses and ...
Jasmin Er +18 more
wiley +1 more source

