Results 51 to 60 of about 111,322 (187)
A Consequence Analysis of the Explosion of Spherical Tanks Containing Liquefied Petroleum Gas (LPG) [PDF]
Iranian Journal of Oil & Gas Science and Technology, 2016 A consequence analysis was performed in one of the gas refineries in Iran to investigate the risks andpotential losses resulted from accidents. Specifically, the consequences of an explosion in LPGspherical tanks were modeled using PHAST and MATLAB ...
Hadi Zareei +2 more
doaj +1 more source
Regionally-triggered geomagnetic reversals
Scientific ReportsSystematic studies of numerical dynamo simulations reveal that the transition from dipole-dominated non-reversing fields to models that exhibit reversals occurs when inertial effects become strong enough. However, the inertial force is expected to play a
Filipe Terra-Nova, Hagay Amit
doaj +1 more source
In-Field Emission Measurements from Biogas and Liquified Petroleum Gas (LPG) Stoves
Atmosphere, 2019 Household air pollution from solid fuel cooking causes millions of deaths each year and contributes to climate change. These emissions can be reduced if households transition to cleaner cooking fuels such as LPG or biogas, yet emission measurements ...
Cheryl L. Weyant +9 more
doaj +1 more source
Kecamatan Tampan oleh Dinas Perindustrian dan Perdagangan Kota Pekanbaru (Studi Kasus: Pangkalan Lpg 3 Kg) [PDF]
, 2015 LPG 3 kg has become a very important requirement. It can be seen from the demand for LPG 3 kg is increasing every year, both in use for households or for the development of micro enterprises. The purpose of this research was to determine how the LPG 3 kg
Faisal, A. (Andini), Yuliani, F. (Febri)
core
PERANCANGAN ALAT PENDETEKSI KEBOCORAN TABUNG GAS LIQUIEFED PETROLEUM GAS (LPG) BERBASIS MIKROKONTROLER PROYEK AKHIR [PDF]
, 2016 Sejakdiluncurkannyakebijakanpemerintahdalammengkonversipemakaianminyaktanahkegas LPG (Liquefied Petroleum Gas) telahmengakibatkanmasyarakatberalihuntukmenggunakankomporgas LPGuntukkeperluansehari-hari.Meskipun gas LPG ...
Is Armuna
core
Salus CulturaTransitioning to cleaner cooking energy sources like LPG and biogas is essential for achieving sustainable development in rural Indonesia. This study, utilizing data from over 84,000 villages in the 2021 Village Potential Survey (PODES), examines the ...
Indri Islamiati, Andre Lofika Pegi
doaj +1 more source
Environmental Research Letters, 2020 The use of clean fuel such as liquid petroleum gas (LPG) is globally recommended for household cooking to reduce exposure to household air pollution and its adverse health consequences.
Sk Masum Billah +5 more
doaj +1 more source
On the Effective Configuration of Planning Domain Models [PDF]
, 2015 The development of domain-independent planners within the AI Planning community is leading to “off the shelf” technology that can be used in a wide range of applications.
Chrpa, Lukáš +3 more
core
Recent aqueous alteration associated to sedimentary volcanism on Mars
Communications Earth & EnvironmentSedimentary volcanism, whereby material is brought to the surface by fluid overpressure, has been proposed to explain some of the periglacial landforms, including pitted cones, in the Northern Plains of Mars.
M. Pineau +7 more
doaj +1 more source
Considering a lexicographic plan for Gabon within the Gabonese language landscape [PDF]
, 2009 This article raises a number of questions that should be dealt with in drawing up a lexicographic plan for Gabon. For which of the Gabonese languages should lexicographic units be established? This question entrains the issue of inventorying the Gabonese
Ndinga-Koumba-Binza, Hugues Steve
core