Isolation, Genomics-Based and Biochemical Characterization of Bacteriocinogenic Bacteria and Their Bacteriocins, Sourced from the Gastrointestinal Tract of Meat-Producing Pigs
Abstract
1. Introduction
2. Results
2.1. Isolation of Bacterial Strains and Identification of the Most Active Isolates
2.2. Whole Genome Sequencing (WGS), Bioinformatic Identification of Bacteriocins and In Vitro Cell-Free Protein Synthesis (IV-CFPS) of Bacteriocins Encoded by Selected Gram-Negative Producers
2.3. Whole Genome Sequencing (WGS) and Bioinformatic Identification of Bacteriocins Encoded by Selected Gram-Positive Producers
2.4. In Vitro Cell-Free Protein Synthesis (IV-CFPS) of Bacteriocins Encoded by Selected Gram-Positive Strains and Evaluation of Their Antimicrobial Activity
2.5. Colony MALDI-TOF MS Analysis of Bacteriocins Encoded by Selected Gram-Positive Strains
2.6. Purification of the Bacteriocins Produced by P. lentus P8CEA5, MALDI-TOF MS Analysis, and LC-MS/MS Evaluation by Targeted Proteomics Combined with Massive Peptide Analysis of the Trypsinized Fractions
3. Discussion
4. Materials and Methods
4.1. Samples Collection, Isolation of Bacterial Strains and Growth Conditions
4.2. Antimicrobial Activity Assays
4.3. DNA Isolation and Purification, RAPD-PCR, and 16S rDNA Sequencing for Identification of the Most Active Bacterial Isolates
4.4. Genomic DNA Isolation, Whole Genome Sequencing (WGS) and Assembly, Genome Annotation and Species Identification
4.5. Bioinformatic Screening of Biosynthetic Gene Clusters Encoding Bacteriocins
4.6. Hemolytic and Gelatinase Activities
4.7. In Vitro Cell-Free Protein Synthesis (IV-CFPS) of Mature Bacteriocins and Evaluation of Their Antimicrobial Activity
4.8. In Vitro Cell-Free Protein Synthesis (IV-CFPS) Coupled to a Split-Intein-Mediated Ligation (SIML) Procedure for Synthesis, Production and Determination of the Antimicrobial Activity of Putative Circular Bacteriocins
4.9. Colony Matrix-Assisted Laser Desorption/Ionisation-Time of Flight Mass Spectrometry (MALDI-TOF MS) Analysis
4.10. Growth Conditions and Antimicrobial Activity of Paenibacillus lentus P8CEA5
4.11. Purification of the Bacteriocins Produced by P. lentus P8CEA5, MALDI-TOF MS Analysis, and LC-MS/MS Evaluation by Targeted Proteomics Combined with Massive Peptide Analysis of the Trypsinized Purified Fractions
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Marshall, B.M.; Levy, S.B. Food Animals and Antimicrobials: Impacts on Human Health. Clin. Microbiol. Rev. 2011, 24, 718–733. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Y.; Zhang, Y.; Liu, F.; Mao, Y.; Zhang, Y.; Zeng, H.; Ren, S.; Guo, L.; Chen, Z.; Hrabchenko, N.; et al. Mechanisms and Applications of Probiotics in Prevention and Treatment of Swine Diseases. Porc. Health Manag. 2023, 9, 5. [Google Scholar] [CrossRef] [PubMed]
- Pereira, W.A.; Franco, S.M.; Reis, I.L.; Mendonça, C.M.N.; Piazentin, A.C.M.; Azevedo, P.O.S.; Tse, M.L.P.; De Martinis, E.C.P.; Gierus, M.; Oliveira, R.P.S. Beneficial Effects of Probiotics on the Pig Production Cycle: An Overview of Clinical Impacts and Performance. Vet. Microbiol. 2022, 269, 109431. [Google Scholar] [CrossRef] [PubMed]
- Ben Lagha, A.; Haas, B.; Gottschalk, M.; Grenier, D. Antimicrobial Potential of Bacteriocins in Poultry and Swine Production. Vet. Res. 2017, 48, 22. [Google Scholar] [CrossRef] [PubMed]
- Telhig, S.; Ben Said, L.; Zirah, S.; Fliss, I.; Rebuffat, S. Bacteriocins to Thwart Bacterial Resistance in Gram Negative Bacteria. Front. Microbiol. 2020, 11, 586433. [Google Scholar] [CrossRef]
- Ali, M.S.; Lee, E.B.; Hsu, W.H.; Suk, K.; Sayem, S.A.J.; Ullah, H.M.A.; Lee, S.J.; Park, S.C. Probiotics and Postbiotics as an Alternative to Antibiotics: An Emphasis on Pigs. Pathogens 2023, 12, 874. [Google Scholar] [CrossRef]
- Azizi, A.F.N.; Uemura, R.; Omori, M.; Sueyoshi, M.; Yasuda, M. Effects of Probiotics on Growth and Immunity of Piglets. Animals 2022, 12, 1786. [Google Scholar] [CrossRef]
- Zimina, M.; Babich, O.; Prosekov, A.; Sukhikh, S.; Ivanova, S.; Shevchenko, M.; Noskova, S. Overview of Global Trends in Classification, Methods of Preparation and Application of Bacteriocins. Antibiotics 2020, 9, 553. [Google Scholar] [CrossRef]
- Upatissa, S.; Mitchell, R.J. The “Cins” of Our Fathers: Rejuvenated Interest in Colicins to Combat Drug Resistance. J. Microbiol. 2023, 61, 145–158. [Google Scholar] [CrossRef]
- Cotter, P.D.; Hill, C.; Ross, R.P. Bacteriocins: Developing Innate Immunity for Food. Nat. Rev. Microbiol. 2005, 3, 777–788. [Google Scholar] [CrossRef]
- Alvarez-Sieiro, P.; Montalbán-López, M.; Mu, D.; Kuipers, O.P. Bacteriocins of Lactic Acid Bacteria: Extending the Family. Appl. Microbiol. Biotechnol. 2016, 100, 2939–2951. [Google Scholar] [CrossRef] [PubMed]
- Montalbán-López, M.; Scott, T.A.; Ramesh, S.; Rahman, I.R.; Van Heel, A.J.; Viel, J.H.; Bandarian, V.; Dittmann, E.; Genilloud, O.; Goto, Y.; et al. New Developments in RiPP Discovery, Enzymology and Engineering. Nat. Prod. Rep. 2021, 38, 130–239. [Google Scholar] [CrossRef] [PubMed]
- Ongpipattanakul, C.; Desormeaux, E.K.; Dicaprio, A.; Van Der Donk, W.A.; Mitchell, D.A.; Nair, S.K. Mechanism of Action of Ribosomally Synthesized and Post-Translationally Modified Peptides. Chem. Rev. 2022, 122, 14722–14814. [Google Scholar] [CrossRef] [PubMed]
- Sevillano, E.; Lafuente, I.; Peña, N.; Cintas, L.M.; Muñoz-Atienza, E.; Hernández, P.E.; Borrero, J. Evaluation of Safety and Probiotic Traits from a Comprehensive Genome-Based In Silico Analysis of Ligilactobacillus Salivarius P1CEA3, Isolated from Pigs and Producer of Nisin S. Foods 2023, 13, 107. [Google Scholar] [CrossRef]
- Sevillano, E.; Peña, N.; Lafuente, I.; Cintas, L.M.; Muñoz-Atienza, E.; Hernández, P.E.; Borrero, J. Nisin S, a Novel Nisin Variant Produced by Ligilactobacillus Salivarius P1CEA3. Int. J. Mol. Sci. 2023, 24, 6813. [Google Scholar] [CrossRef]
- Vieco-Saiz, N.; Belguesmia, Y.; Raspoet, R.; Auclair, E.; Gancel, F.; Kempf, I.; Drider, D. Benefits and Inputs From Lactic Acid Bacteria and Their Bacteriocins as Alternatives to Antibiotic Growth Promoters During Food-Animal Production. Front. Microbiol. 2019, 10, 57. [Google Scholar] [CrossRef]
- Robles Ramirez, O.; Osuna, G.; Plisson, F.; Barrientos-Salcedo, C. Antimicrobial Peptides in Livestock: A Review with a One Health Approach. Front. Cell Infect. Microbiol. 2024, 14, 1339285. [Google Scholar] [CrossRef]
- Kim, H.B.; Isaacson, R.E. The Pig Gut Microbial Diversity: Understanding the Pig Gut Microbial Ecology through the next Generation High Throughput Sequencing. Vet. Microbiol. 2015, 177, 242–251. [Google Scholar] [CrossRef]
- Dobson, A.; Cotter, P.D.; Paul Ross, R.; Hill, C. Bacteriocin Production: A Probiotic Trait? Appl. Environ. Microbiol. 2012, 78, 242–251. [Google Scholar] [CrossRef]
- Jin, X.; Kightlinger, W.; Kwon, Y.C.; Hong, S.H. Rapid Production and Characterization of Antimicrobial Colicins Using Escherichia Coli-Based Cell-Free Protein Synthesis. Synth. Biol. 2018, 3, ysy004. [Google Scholar] [CrossRef]
- Kuznetsova, M.V.; Mihailovskaya, V.S.; Remezovskaya, N.B.; Starčič Erjavec, M. Bacteriocin-Producing Escherichia Coli Isolated from the Gastrointestinal Tract of Farm Animals: Prevalence, Molecular Characterization and Potential for Application. Microorganisms 2022, 10, 1558. [Google Scholar] [CrossRef]
- Michel-Briand, Y.; Baysse, C. The Pyocins of Pseudomonas Aeruginosa. Biochimie 2002, 84, 499–510. [Google Scholar] [CrossRef]
- Alqahtani, A.; Kopel, J.; Hamood, A. The In Vivo and In Vitro Assessment of Pyocins in Treating Pseudomonas Aeruginosa Infections. Antibiotics 2022, 11, 1366. [Google Scholar] [CrossRef]
- Yang, K.M.; Kim, J.S.; Kim, H.S.; Kim, Y.Y.; Oh, J.K.; Jung, H.W.; Park, D.S.; Bae, K.H. Lactobacillus Reuteri AN417 Cell-Free Culture Supernatant as a Novel Antibacterial Agent Targeting Oral Pathogenic Bacteria. Sci. Rep. 2021, 11, 1631. [Google Scholar] [CrossRef]
- Jiang, J.; Li, K.; Xiao, Y.; Zhong, A.; Tang, J.; Duan, Y.; Li, Z. Limosilactobacillus Reuteri Regulating Intestinal Function: A Review. Fermentation 2022, 9, 19. [Google Scholar] [CrossRef]
- Fremaux, C.; Klaenhammer, T.R. Helveticin J, A Large Heat-Labile Bacteriocin from Lactobacillus Helveticus. In Bacteriocins of Lactic Acid Bacteria; De Vuyst, L., Vandamme, E.J., Eds.; Bacteriocins of Lactic Acid Bacteria; Springer: Boston, MA, USA, 1994; pp. 397–418. [Google Scholar] [CrossRef]
- Joerger, M.C.; Klaenhammer, T.R. Characterization and Purification of Helveticin J and Evidence for a Chromosomally Determined Bacteriocin Produced by Lactobacillus Helveticus 481. J. Bacteriol. 1986, 167, 439–446. [Google Scholar] [CrossRef]
- Meng, F.; Zhu, X.; Zhao, H.; Nie, T.; Lu, F.; Lu, Z.; Lu, Y. A Class Ⅲ Bacteriocin with Broad-Spectrum Antibacterial Activity from Lactobacillus Acidophilus NX2-6 and Its Preservation in Milk and Cheese. Food Control 2021, 121, 107597. [Google Scholar] [CrossRef]
- Niu, D.; Feng, N.; Xi, S.; Xu, J.; Su, Y. Genomics-Based Analysis of Four Porcine-Derived Lactic Acid Bacteria Strains and Their Evaluation as Potential Probiotics. Mol. Genet. Genom. 2024, 299, 24. [Google Scholar] [CrossRef]
- O’ Connor, P.M.; O’ Shea, E.F.; Cotter, P.D.; Hill, C.; Ross, R.P. The Potency of the Broad Spectrum Bacteriocin, Bactofencin A, against Staphylococci Is Highly Dependent on Primary Structure, N-Terminal Charge and Disulphide Formation. Sci. Rep. 2018, 8, 11833. [Google Scholar] [CrossRef]
- Maldonado, A.; Ruiz-Barba, J.L.; Jiménez-Díaz, R. Purification and Genetic Characterization of Plantaricin NC8, a Novel Coculture-Inducible Two-Peptide Bacteriocin from Lactobacillus Plantarum NC8. Appl. Environ. Microbiol. 2003, 69, 383–389. [Google Scholar] [CrossRef]
- Jiménez-Díaz, R.; Rios-Sánchez, R.M.; Desmazeaud, M.; Ruiz-Barba, J.L.; Piard, J.-C. Plantaricins S and T, Two New Bacteriocins Produced by Lactobacillus Plantarum LPCO10 Isolated from a Green Olive Fermentation. Appl. Environ. Microbiol. 1993, 59, 1416–1424. [Google Scholar] [CrossRef] [PubMed]
- O’Shea, E.F.; O’Connor, P.M.; Raftis, E.J.; O’Toole, P.W.; Stanton, C.; Cotter, P.D.; Ross, R.P.; Hill, C. Production of Multiple Bacteriocins from a Single Locus by Gastrointestinal Strains of Lactobacillus Salivarius. J. Bacteriol. 2011, 193, 6973–6982. [Google Scholar] [CrossRef] [PubMed]
- Fremaux, C.; Ahn, C.; Klaenhammer, T.R. Molecular Analysis of the Lactacin F Operon. Appl. Environ. Microbiol. 1993, 59, 3906–3915. [Google Scholar] [CrossRef] [PubMed]
- Soltani, S.; Biron, E.; Ben Said, L.; Subirade, M.; Fliss, I. Bacteriocin-Based Synergetic Consortia: A Promising Strategy to Enhance Antimicrobial Activity and Broaden the Spectrum of Inhibition. Microbiol. Spectr. 2022, 10, e0040621. [Google Scholar] [CrossRef]
- Eltokhy, M.A.; Saad, B.T.; Eltayeb, W.N.; Yahia, I.S.; Aboshanab, K.M.; Ashour, M.S.E. Exploring the Nature of the Antimicrobial Metabolites Produced by Paenibacillus Ehimensis Soil Isolate Mz921932 Using a Metagenomic Nanopore Sequencing Coupled with Lc-Mass Analysis. Antibiotics 2022, 11, 12. [Google Scholar] [CrossRef]
- Van Quyen, D.; Moore, R.J.; Minh Khánh, C.; Thu Hao Van, T.; Vuong, H.; Tho, L.; Trang, N.; Hoa, K. Heterologously Expressed SacP23, a Novel Bacteriocin from Paenibacillus Polymyxa #23, Is Active against Methicillin Resistant Staphylococcus Aureus. R. Soc. Open Sci. 2023, 10, 231119. [Google Scholar] [CrossRef]
- Teber, R.; Asakawa, S. In Silico Screening of Bacteriocin Gene Clusters within a Set of Marine Bacillota Genomes. Int. J. Mol. Sci. 2024, 25, 2566. [Google Scholar] [CrossRef]
- Zhu, S.; Hegemann, J.D.; Fage, C.D.; Zimmermann, M.; Xie, X.; Linne, U.; Marahiel, M.A. Insights into the Unique Phosphorylation of the Lasso Peptide Paeninodin. J. Biol. Chem. 2016, 291, 13662–13678. [Google Scholar] [CrossRef]
- Lajis, A.F.B. Biomanufacturing Process for the Production of Bacteriocins from Bacillaceae Family. Bioresour. Bioprocess. 2020, 7, 8. [Google Scholar] [CrossRef]
- Gray, E.J.; Lee, K.D.; Souleimanov, A.M.; Di Falco, M.R.; Zhou, X.; Ly, A.; Charles, T.C.; Driscoll, B.T.; Smith, D.L. A Novel Bacteriocin, Thuricin 17, Produced by Plant Growth Promoting Rhizobacteria Strain Bacillus Thuringiensis NEB17: Isolation and Classification. J. Appl. Microbiol. 2006, 100, 545–554. [Google Scholar] [CrossRef]
- Lee, H.; Churey, J.J.; Worobo, R.W. Biosynthesis and Transcriptional Analysis of Thurincin H, a Tandem Repeated Bacteriocin Genetic Locus, Produced by Bacillus Thuringiensis SF361. FEMS Microbiol. Lett. 2009, 299, 205–213. [Google Scholar] [CrossRef] [PubMed]
- Sit, C.S.; Van Belkum, M.J.; McKay, R.T.; Worobo, R.W.; Vederas, J.C. The 3D Solution Structure of Thurincin H, a Bacteriocin with Four Sulfur to α-Carbon Crosslinks. Angew. Chem. Int. Ed. Engl. 2011, 50, 8718–8721. [Google Scholar] [CrossRef] [PubMed]
- Sung, Y.J.; Li, Y.; Wang, Y.; Chen, Y.; Zhao, Y.; Qin, J. Complications in the Assignment of 14 and 28 Da Mass Shift Detected by Mass Spectrometry as in Vivo Methylation from Endogenous Proteins. Anal. Chem. 2008, 80, 1721–1729. [Google Scholar] [CrossRef]
- Liu, F.; van Heel, A.J.; Kuipers, O.P. Engineering Circular Bacteriocins: Structural and Functional Effects of α-Helix Exchanges and Disulfide Introductions in Circularin A. Front. Microbiol. 2024, 15, 1337647. [Google Scholar] [CrossRef]
- Acedo, J.Z.; Chiorean, S.; Vederas, J.C.; van Belkum, M.J. The Expanding Structural Variety among Bacteriocins from Gram-Positive Bacteria. FEMS Microbiol. Rev. 2018, 42, 805–828. [Google Scholar] [CrossRef]
- Malmström, J.; Lee, H.; Aebersold, R. Advances in Proteomic Workflows for Systems Biology. Curr. Opin. Biotechnol. 2007, 18, 378. [Google Scholar] [CrossRef] [PubMed]
- Sandiford, S.; Upton, M. Identification, Characterization, and Recombinant Expression of Epidermicin NI01, a Novel Unmodified Bacteriocin Produced by Staphylococcus Epidermidis That Displays Potent Activity against Staphylococci. Antimicrob. Agents Chemother. 2012, 56, 1539. [Google Scholar] [CrossRef]
- Netz, D.J.A.; Bastos, M. do C. de F.; Sahl, H.G. Mode of Action of the Antimicrobial Peptide Aureocin A53 from Staphylococcus Aureus. Appl. Environ. Microbiol. 2002, 68, 5274. [Google Scholar] [CrossRef]
- Zhang, X.; Xin, N.; Zhu, Z.; Li, X.; Dai, D.; Pan, C.; Peng, D.; Sun, M. Three Novel Leaderless Bacteriocins Have Antimicrobial Activity against Gram-Positive Bacteria to Serve as Promising Food Biopreservative. Microb. Cell Fact. 2022, 21, 194. [Google Scholar] [CrossRef]
- Major, D.; Flanzbaum, L.; Lussier, L.; Davies, C.; Caldo, K.M.P.; Acedo, J.Z. Transporter Protein-Guided Genome Mining for Head-to-Tail Cyclized Bacteriocins. Molecules 2021, 26, 7218. [Google Scholar] [CrossRef]
- de Freire Bastos, M.D.C.; Varella Coelho, M.L.; da Silva Santos, O.C. Resistance to Bacteriocins Produced by Gram-Positive Bacteria. Microbiology 2015, 161, 683–700. [Google Scholar] [CrossRef] [PubMed]
- Fiore, E.; Van Tyne, D.; Gilmore, M.S. Pathogenicity of Enterococci. Microbiol. Spectr. 2019, 7, 10. [Google Scholar] [CrossRef] [PubMed]
- Hao, W.; Tian, P.; Zheng, M.; Wang, H.; Xu, C. Characteristics of Proteolytic Microorganisms and Their Effects on Proteolysis in Total Mixed Ration Silages of Soybean Curd Residue. Asian-Australas. J. Anim. Sci. 2020, 33, 100. [Google Scholar] [CrossRef] [PubMed]
- Ehlers, S.; Merrill, S.A. Staphylococcus Saprophyticus Infection; Statpearls Publishing: Treasure Island, FL, USA, 2023. [Google Scholar] [CrossRef]
- Cheung, G.Y.C.; Bae, J.S.; Otto, M. Pathogenicity and Virulence of Staphylococcus Aureus. Virulence 2021, 12, 547. [Google Scholar] [CrossRef]
- Li, H.; Fan, H.; Lu, K.; Zhu, Q.; Wu, J. Purification of Extracellular Protease from Staphylococcus Simulans QB7and Its Ability in Generating Antioxidant and Anti-Inflammatory Peptides from Meat Proteins. Nutrients 2023, 15, 65. [Google Scholar] [CrossRef] [PubMed]
- Li, H.; Zhu, Q.; Chen, X.; Zhou, J.; Wu, J. Isolation and Characterization of Coagulase Negative Staphylococci with High Proteolytic Activity from Dry Fermented Sausages as a Potential Starter Culture. Food Res. Int. 2022, 162, 111957. [Google Scholar] [CrossRef]
- Hindré, T.; Didelot, S.; Le Pennec, J.P.; Haras, D.; Dufour, A.; Vallée-Réhel, K. Bacteriocin Detection from Whole Bacteria by Matrix-Assisted Laser Desorption Ionization-Time of Flight Mass Spectrometry. Appl. Environ. Microbiol. 2003, 69, 1051–1058. [Google Scholar] [CrossRef]
- Gabant, P.; Borrero, J. PARAGEN 1.0: A Standardized Synthetic Gene Library for Fast Cell-Free Bacteriocin Synthesis. Front. Bioeng. Biotechnol. 2019, 7, 213. [Google Scholar] [CrossRef]
- Peña, N.; Bland, M.J.; Sevillano, E.; Muñoz-Atienza, E.; Lafuente, I.; Bakkoury, M.E.; Cintas, L.M.; Hernández, P.E.; Gabant, P.; Borrero, J. In Vitro and in Vivo Production and Split-Intein Mediated Ligation (SIML) of Circular Bacteriocins. Front. Microbiol. 2022, 13, 1052686. [Google Scholar] [CrossRef]
- Lafuente, I.; Sevillano, E.; Peña, N.; Cuartero, A.; Hernández, P.E.; Cintas, L.M.; Muñoz-Atienza, E.; Borrero, J. Production of Pumilarin and a Novel Circular Bacteriocin, Altitudin A, by Bacillus Altitudinis ECC22, a Soil-Derived Bacteriocin Producer. Int. J. Mol. Sci. 2024, 25, 2020. [Google Scholar] [CrossRef]
- Weisburg, W.G.; Barns, S.M.; Pelletier, D.A.; Lane, D.J. 16S Ribosomal DNA Amplification for Phylogenetic Study. J. Bacteriol. 1991, 173, 697–703. [Google Scholar] [CrossRef] [PubMed]
- Wattam, A.R.; Davis, J.J.; Assaf, R.; Boisvert, S.; Brettin, T.; Bun, C.; Conrad, N.; Dietrich, E.M.; Disz, T.; Gabbard, J.L.; et al. Improvements to PATRIC, the All-Bacterial Bioinformatics Database and Analysis Resource Center. Nucleic Acids Res. 2017, 45, D535–D542. [Google Scholar] [CrossRef] [PubMed]
- Wick, R.R.; Judd, L.M.; Gorrie, C.L.; Holt, K.E. Unicycler: Resolving Bacterial Genome Assemblies from Short and Long Sequencing Reads. PLoS Comput. Biol. 2017, 13, e1005595. [Google Scholar] [CrossRef] [PubMed]
- Overbeek, R.; Olson, R.; Pusch, G.D.; Olsen, G.J.; Davis, J.J.; Disz, T.; Edwards, R.A.; Gerdes, S.; Parrello, B.; Shukla, M.; et al. The SEED and the Rapid Annotation of Microbial Genomes Using Subsystems Technology (RAST). Nucleic Acids Res. 2014, 42, D206–D214. [Google Scholar] [CrossRef]
- Larsen, M.V.; Cosentino, S.; Lukjancenko, O.; Saputra, D.; Rasmussen, S.; Hasman, H.; Sicheritz-Pontén, T.; Aarestrup, F.M.; Ussery, D.W.; Lund, O. Benchmarking of Methods for Genomic Taxonomy. J. Clin. Microbiol. 2014, 52, 1529–1539. [Google Scholar] [CrossRef]
- Van Heel, A.J.; De Jong, A.; Song, C.; Viel, J.H.; Kok, J.; Kuipers, O.P. BAGEL4: A User-Friendly Web Server to Thoroughly Mine RiPPs and Bacteriocins. Nucleic Acids Res. 2018, 46, W278–W281. [Google Scholar] [CrossRef]
- Blin, K.; Shaw, S.; Kloosterman, A.M.; Charlop-Powers, Z.; Van Wezel, G.P.; Medema, M.H.; Weber, T. AntiSMASH 6.0: Improving Cluster Detection and Comparison Capabilities. Nucleic Acids Res. 2021, 49, W29–W35. [Google Scholar] [CrossRef]
- Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic Local Alignment Search Tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
- UniProt Consortium. UniProt: The universal protein knowledgebase in 2021. Nucleic Acids Res 2021, 49, D480–D489. [Google Scholar] [CrossRef]
- Darling, A.E.; Mau, B.; Perna, N.T. ProgressiveMauve: Multiple Genome Alignment with Gene Gain, Loss and Rearrangement. PLoS ONE 2010, 5, e11147. [Google Scholar] [CrossRef]
- Muñoz-Atienza, E.; Gómez-Sala, B.; Araújo, C.; Campanero, C.; Del Campo, R.; Hernández, P.E.; Herranz, C.; Cintas, L.M. Antimicrobial Activity, Antibiotic Susceptibility and Virulence Factors of Lactic Acid Bacteria of Aquatic Origin Intended for Use as Probiotics in Aquaculture. BMC Microbiol. 2013, 13, 15. [Google Scholar] [CrossRef] [PubMed]
Producer Strains | Indicator Strains | |||||||||
---|---|---|---|---|---|---|---|---|---|---|
E. coli | S. Choleraesuis | S. paratyphi | ||||||||
DH5α | ZTA16/ 01940 | ZTA16/ 01878 | ZTA16/ 01937 | ZTA16/ 01268 | ZTA16/ 02317 | ZTA19/ 01344 | ZTA19/ 01349 | ZTA19/ 01351 | CECT 554 | |
P. alcaligenes PG7 | + | ++ | + | - | - | - | - | - | - | - |
E. coli PG9 | ++ | ++ | ++ | + | ++ | ++ | - | - | - | |
E. coli PG14 | +++ | + | + | + | + | - | - | - | - | - |
E. coli PG15 | - | - | - | - | - | - | ++ | + | + | - |
E. coli PG18 | + | - | - | + | - | - | - | - | - | |
E. coli P8CEA3 | ++ | ++ | + | ++ | + | - | - | - | - | - |
E. coli P8COA2 | +++ | +++ | +++ | + | +++ | +++ | - | - | - | ++ |
Producer Strains | Indicator Strains | |||||
---|---|---|---|---|---|---|
P. damnosus CECT 4797 | S. aureus ZTA11/00117ST | S. aureus ZTA11/00310ST | L. seeligeri CECT 917 | S. suis C2969/03 | S. suis CECT 958 | |
L. reuteri P1CEA2 | + | - | - | - | - | - |
L. reuteri P8SIA3 | ++ | +++ | +++ | +++ | +++ | +++ |
L. salivarius P1CEA3 | +++ | + | + | ++ | ++ | ++ |
L. salivarius PG21 | +++ | +++ | +++ | +++ | +++ | +++ |
L. johnsonii P8CEA12 | ++ | ++ | + | ++ | + | + |
L. johnsonii P8COA6 | +++ | ++ | ++ | +++ | ++ | ++ |
L. johnsonii P8COA7 | + | ++ | ++ | +++ | + | + |
P. dendritiformis P1CEA1 | +++ | ++ | ++ | ++ | ++ | ++ |
P. lentus P8CEA4 | - | + | + | ++++ | + | ++ |
P. lentus P8CEA5 | - | + | + | ++++ | + | ++ |
P. lentus P8SIA1 | - | + | + | +++ | + | + |
S. saprophyticus P1CEA4 | +++ | + | + | ++ | ++ | ++ |
S. simulans P8CEA7 | +++ | - | - | +++ | +++ | +++ |
Strain | S-Type Pyocin | BLP | Colicin | Microcin | |||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
E6 | Ia | Ib | E1 | E2 | S4 | 10 | H47 | M | V | B17 | |||
P. alcaligenes PG7 | X | ||||||||||||
E. coli PG9 | X | X | X | X | |||||||||
E. coli PG14 | X | X | X | X | |||||||||
E. coli PG15 | X | X | X | X | |||||||||
E. coli PG18 | X | ||||||||||||
E. coli P8CEA3 | X | X | X | ||||||||||
E. coli P8COA2 | X | X | X | X | X | ||||||||
Amino Acid Sequence | |||||||||||||
S-type pyocin | MTLLRRIDMSGYVANNRDVRSAPEIPVYNGAFDQQPRRQTDRPSPLMPEPLPVPPTQCVFAKPNSLPLGSLDYPSVVPAELASAYGQTAILATTDVPAAGGGLLLARASGQLVGGGTWAIQSAAGAGGTAAGSGATGAAGSGILATAATTAIGFVALLWPSPMGSSDLYPKSELEVLSTAKTRLRFHVEHDWVNGSIRTYGFHTSSRSGFDSVPVVAARAQGEQAVVDLGDGVTILWTPQVDPAVGAPPPPEDIQGLTETVWIYPVSQNAAQALENPIYPSDYKDFIITFPDHPGVQPVYVVLSTQLEKNKVRGREFEDEVYGDYSSTRSETGREVTVKTKSGTRTRIDMVGREPDGTISCVECKSSDTAPLTPNQKVAFPEIEESGAVVVGKGKPGFPGGTEIPPTKVDVVRPN | ||||||||||||
BLP | MGYGLLDIANQSRREALQGISDADRRREEIEAANKQMAAQQKAQNKQNIGTGIGTGAAIGASVGGPVGAVAGAVIGGIAGSLF |
Identification | Strain | Bacteriocin a | Amino Acid Sequence b |
---|---|---|---|
Limosilactobacillus reuteri | P1CEA2 | - | - |
Limosilactobacillus reuteri | P8SIA3 | - | - |
Ligilactobacillus salivarius | P1CEA3 | Salivaricin B | MNNNFVQVDKKELAHIIGGRNSYDYIDSGQFGYDIGCTIANTKFFKRLRHSNQNICS |
Abp118α | MIIMMKEFTVLTECELAKVDGGKRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL | ||
Abp118β | MKNLDKRFTIMTEDNLASVNGGKNGYGGSGNRWVHCGAGIVGGALIGAIGGPWSAVAGGISGGFTSCR | ||
Nisin S (class I) | MSVNDFKLDLVKVSKESTNSNYSVKITSYSLCTPGCKTGALMGCTMKTASCGCHVHISK | ||
Ligilactobacillus salivarius | PG21 | Bactofencin A | MFFNFMKKVDVKKNFGYKEVSRKDLAKVNGGKRKKHRCRVYNNGMPTGMYRWC |
Salivaricin Tα LP | MIIMMKEFTVLTECELAKVDGGYTPKNCAMAVGGGMLSGAIRGGMSGTVFGVGTGNLTGAFAGAHIGLVAGGLACIGGYLGSH | ||
Salivaricin Tβ LP | MSYEKLNNEELSKILGGNGINWGAVVGSCASGAVIGAAFGNPLTGYVANSAFSFSWQAFKNRPHPKKIA | ||
Gassericin T/LactacinF lafA LP | MIIMMDKEFTVLTECELAKVDGGKGSKGSSYVAGFASAAIADTGLGGAICGVPCAMIGAHYAPIGWTIVTGATGGF | ||
Plantaricin NC8α LP | MKVYNEENLAEIIGGRSIEGKIWYGYGYQLGMTARWNLRHPYFQLPYH | ||
Plantaricin NC8β LP | MNKKLNSIDEKDLVKIVGGGSPWSNLIVQGAVAVFKSGYRHRNDIKAGFSAGFYGK | ||
Plantaricin Sα LP | MITMNNLQKFEIISDTTLSHVNGGYNRLAGRIGHYTGKAALWGIAVAGLFLI | ||
Plantaricin Sβ LP | MDNCNNFTSLNNTELQGIIGGKHGLGYHIVDAVVSFGEGFLNAI | ||
Lactobacillus johnsonii | P8CEA12 P8COA7 P8COA6 | Helveticin J LP | MIGRETQICLVNKLENIHHVVVQASAIDGSNVFALQLLHKQSDVVVYQTPNDSETVTFDEDHPILYLKGPNSAGTAGGHTQTWIQSGENNKWFVGTKPKRQGNTYWTTQIARVTVPGYQTQVFANNTDLPRLSYLNRAGAGYGDGGTVYPGKDLVRVEATVSPNGHYFLIASIDINHTGYFALYDLNEVNNKLDAAEEKAEDINIETLTCLGAFKVPHFNDQKIISIQGYGIDDNKDIYISSQPSPHTTFLGFPRQGKPREIVKIPWGMVDPDKWSVVNLDNSLKLDALDFCTEFEGIQVTSDCLYLTVAYHQRNSDLTTLMNRIYQVEKF |
Paenibacillus dendritiformis | P1CEA1 | Proteusin peptide LP | MSIDQMHMNQIVQRAWEDATFKEKLLADPKSAIKELLGISIPEHIQLTTVEEKLNQYVLILPPNPSEVVKDTPVAKRDMWY |
Lasso peptide paeninodin | MKKQYSKPSLEVLDVHQTMAGPGTSTPDAFQPDPDEDVHYDS | ||
Class I lanthipeptide paenicidin LP | MENNLFDLDIQVKKSSDNIEPQVLSVWRCSGGCSDDGRTSATCVATAGKSCFTNIGSLC | ||
Heterocycloanthracin/sonorensin LP | MSDFQKDLQNLNVGKFSSTGMTPASGQNQSGPGDPRLCVGICFFCIGFCGGFCSCGNCFRCSNCFRCSNCFNCANCSNCARCGSCARCR | ||
Paenibacillus lentus | P8CEA4 P8CEA5 P8SIA1 | Proteusin peptide LP | MTTSGALLQTQIIQKAWQDPSFKAKLLADPKAAIQEVLGVTIPDHIKVKTIEENSDEFYLVLPPNPSEVVKSDIKPNAVWGN |
Sactipeptide thuricin 17 LP (lentucin S) | MVTPSVEPNGITCWGCLACAACTVTALTLVSALSGLNTID | ||
Circular bacteriocin PL1 | MRAQILKKDTKLFISMSLVVVLSSMLLFTFKFAAVNLGLSASTATLLYTALNAIAWGATAAGIVASFGLGAIAAQAIWSYVKKHTLKQFLQY | ||
Circular bacteriocin PL2 | MVLKKDSKAIFFVSLSILLSTLLLMNFHNAAVTIGISEGLATNIYFALQWVSWGATAAAIVASFGLGAIVAQTIWAAVKKQALKEFVKW | ||
Class III lanthipeptide LP | MNDVLALQQLAAAPEEQELFPITITWTVTTTVATWSTASNHC | ||
Thermophilin A LP | MDSVMQLNGFSELSLNEMMSIDGGADFSWKDLGKSVVGGAASGAIGGGAAGAMAGGVGAGPGALVGGAAGAVGGAAAYLLTYWW | ||
Staphylococcus saprophyticus | P1CEA4 | Epidermicin LP (saprophyticin S) | MGAFLKFVGWLATKGKKYVKIAWDHKGTIMKWLNAGQTFTWVYEQIKKLWT |
Staphylococcus simulans | P8CEA7 | Lactococcin 972 LP | MKKYVARTIIIATLLLGMGTTTIANAYEWAEGGKWSHGIGSTYVWSYYTHNSYGHDSTAIGKYRSDSGYTTAGKQARASAKKAWWGNQAYYRVY |
Class II lanthipeptide α LP | MTKKDLLSSAKKDYLEKVDISDDKLEDVQGGKCPWYNVSCQLGNDGKICTFSHECTGGCNTSA | ||
Class II lanthipeptide β LP | MSLFKKDIKRNVNAENNLKKVSNVEDKQGGTTTVPCAVAASVALCPTLVCSNKCGDRG |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Sevillano, E.; Lafuente, I.; Peña, N.; Cintas, L.M.; Muñoz-Atienza, E.; Hernández, P.E.; Borrero, J. Isolation, Genomics-Based and Biochemical Characterization of Bacteriocinogenic Bacteria and Their Bacteriocins, Sourced from the Gastrointestinal Tract of Meat-Producing Pigs. Int. J. Mol. Sci. 2024, 25, 12210. https://doi.org/10.3390/ijms252212210
Sevillano E, Lafuente I, Peña N, Cintas LM, Muñoz-Atienza E, Hernández PE, Borrero J. Isolation, Genomics-Based and Biochemical Characterization of Bacteriocinogenic Bacteria and Their Bacteriocins, Sourced from the Gastrointestinal Tract of Meat-Producing Pigs. International Journal of Molecular Sciences. 2024; 25(22):12210. https://doi.org/10.3390/ijms252212210
Chicago/Turabian StyleSevillano, Ester, Irene Lafuente, Nuria Peña, Luis M. Cintas, Estefanía Muñoz-Atienza, Pablo E. Hernández, and Juan Borrero. 2024. "Isolation, Genomics-Based and Biochemical Characterization of Bacteriocinogenic Bacteria and Their Bacteriocins, Sourced from the Gastrointestinal Tract of Meat-Producing Pigs" International Journal of Molecular Sciences 25, no. 22: 12210. https://doi.org/10.3390/ijms252212210
APA StyleSevillano, E., Lafuente, I., Peña, N., Cintas, L. M., Muñoz-Atienza, E., Hernández, P. E., & Borrero, J. (2024). Isolation, Genomics-Based and Biochemical Characterization of Bacteriocinogenic Bacteria and Their Bacteriocins, Sourced from the Gastrointestinal Tract of Meat-Producing Pigs. International Journal of Molecular Sciences, 25(22), 12210. https://doi.org/10.3390/ijms252212210