Results 41 to 50 of about 120,730 (287)
Pharmaceutics, 2021 This review focuses on the design of mesoporous silica nanoparticles for infection treatment. Written within a general context of contributions in the field, this manuscript highlights the major scientific achievements accomplished by professor Vallet ...
Elena Álvarez +5 more
doaj +1 more source
Sequestration of CO2 using Cu nanoparticles supported on spherical and rod-shape mesoporous silica
Journal of Saudi Chemical Society, 2018 The CO2 sequestration is one of the most promising solutions to tackle global warming. In this study, spherical mesoporous silica particles (MPS-S) and rod-shaped mesoporous silica particles (MPS-R) loaded with Cu nanoparticles were selectively prepared ...
Nezar H. Khdary +3 more
doaj +1 more source
Nano Biomedicine and Engineering, 2021 A multifunctional trastuzumab-nanoparticle-fluorocarbon system was developed to maximize the diagnostic effects in human epidermal growth factor receptor 2 (HER2)-positive breast cancer. The mesoporous silica nanoparticle shape (e.g. amorphous, spherical,
Melissa Ronni Laughter +5 more
doaj +1 more source
Molecules, 2022 Psoriasis is a chronic inflammatory skin disorder accompanied by excessive keratinocyte proliferation. Erianin (Eri) is an ideal drug candidate for inhibiting proliferation and inducing apoptosis in the treatment of psoriasis.
Huanan Yu +4 more
doaj +1 more source
Mesoporous Silica Nanoparticles: A Comprehensive Review on Synthesis and Recent Advances
Pharmaceutics, 2018 Recent advancements in drug delivery technologies utilizing a variety of carriers have resulted in a path-breaking revolution in the approach towards diagnosis and therapy alike in the current times.
R. Narayan +3 more
semanticscholar +1 more source
Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles.
ACS Nano, 2021 In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]).
S. M. Häffner +9 more
semanticscholar +1 more source
Mesoporous Silica Nanoparticles Improve Oral Delivery of Antitubercular Bicyclic Nitroimidazoles
ACS Biomaterials Science & Engineering, 2021 Pretomanid and MCC7433, a novel nitroimidazopyrazinone analog, are promising antitubercular agents that belong to the bicyclic nitroimidazole family.
C. W. Ang +6 more
semanticscholar +1 more source
The pore size of mesoporous silica nanoparticles regulates their antigen delivery efficiency
Science Advances, 2020 The strength of humoral and cellular immune responses is regulated by the properties of mesoporous silica. Subunit vaccines generally proceed through a 4-step in vivo cascade—the DUMP cascade—to generate potent cell-mediated immune responses: (1 ...
Xiaoyu Hong +8 more
semanticscholar +1 more source
Silica-based mesoporous nanoparticles for controlled drug delivery
Journal of Tissue Engineering, 2013 Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or ...
Sooyeon Kwon +5 more
doaj +1 more source
Journal of Materials Research and Technology, 2023 The present study pointedly investigates the synthesis of mesoporous silica nanoparticles (sol–gel method) using four different surfactants (biosurfactants, CTAB, SDS and tween-80) under mild condition, was characterized by XRD (Low and wide angle), FTIR,
Raju Kumar Sharma +9 more
doaj +1 more source