Results 61 to 70 of about 53,400 (215)

Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]

FEBS Letters, 1994
Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire   +2 more sources

Nanomaterial‐based immune therapeutic strategies in neurodegenerative diseases

BMEMat, EarlyView.
This review highlights the immunomodulatory potential of nanomaterials (NMs) in treating neurodegenerative diseases (NDs). It focuses on their roles in regulating innate and adaptive immune responses to maintain immune homeostasis. By providing insights into these mechanisms, the review lays the groundwork for innovative NMs therapeutic strategies to ...
Xinru Zhou, Jia Liu, Shulin Lai, Suhan Yin, Bingmin Luo, Longquan Shao, Yiyuan Kang   +6 more
wiley   +1 more source

Inhibitors of Cyclophilin A: Current and Anticipated Pharmaceutical Agents for Inflammatory Diseases and Cancers

Molecules
Cyclophilin A, a widely prevalent cellular protein, exhibits peptidyl-prolyl cis-trans isomerase activity. This protein is predominantly located in the cytosol; additionally, it can be secreted by the cells in response to inflammatory stimuli ...
Xuemei Zhao, Xin Zhao, Weihua Di, Chang Wang   +3 more
doaj   +1 more source

Overexpression of Golgi Protein CYP21-4s Improves Crop Productivity in Potato and Rice by Increasing the Abundance of Mannosidic Glycoproteins

Frontiers in Plant Science, 2017
CYP21-4 is a novel Golgi-localized cyclophilin protein involved in oxidative stress tolerance. Here, we generated transgenic plants overexpressing AtCYP21-4 and OsCYP21-4 in potato and rice, respectively.
Hyun Ji Park, Areum Lee, Areum Lee, Sang Sook Lee, Dong-Ju An, Ki-Beom Moon, Jun Cheul Ahn, Hyun-Soon Kim, Hye Sun Cho, Hye Sun Cho   +9 more
doaj   +1 more source

Tadalafil improves lean mass and endothelial function in nonobese men with mild ED/LUTS: in vivo and in vitro characterization [PDF]

, 2017
PURPOSE: Phosphodiesterase type-5 inhibitor administration in diabetic men with erectile dysfunction (ED) is associated with reduced waist circumference.
Aversa, Antonio, Bimonte, VIVIANA MARIA, Crescioli, Clara, Di Luigi, Luigi, Fittipaldi, Simona, Francomano, Davide, Greco, Emanuela A., Lenzi, Andrea, Migliaccio, Silvia   +8 more
core   +1 more source

Cyclophilin polymorphism and virus infection

Current Opinion in Virology, 2015
Viruses are obligate intracellular parasites. All stages of their replication cycle depend on support by host-encoded factors. However, sequence variation also exists in host factors mostly in the form of single nucleotide polymorphisms (SNPs). Several coding and non-coding genetic variants in the PPIA gene encoding for CypA have been described, but ...
von Hahn, Thomas, Ciesek, Sandra
openaire   +2 more sources

Identification of cyclophilin-40-interacting proteins reveals potential cellular function of cyclophilin-40 [PDF]

Analytical Biochemistry, 2011
Cyclophilin-40 (CyP40) is part of the immunophilin family and is found in Hsp90-containing protein complexes. We were interested in identifying proteins that interact with CyP40. CyP40-interacting proteins in HeLa cells were identified using the tandem affinity purification approach.
Miki Susanto, Park, Feixia, Chu, Jinghang, Xie, Yu, Wang, Pompeya, Bhattacharya, William K, Chan   +5 more
openaire   +3 more sources

Engineering Lipid Nanoparticles for Precision RNA Delivery: Design Principles, Targeting Strategies, and Clinical Prospects

Cancer Nexus, EarlyView.
ABSTRACT Lipid nanoparticles (LNPs) represent the most clinically advanced platform for RNA delivery and have enabled major breakthroughs in vaccines and gene therapies. However, their broader application is still limited by inefficient extrahepatic delivery, immunogenicity, and insufficient control over tissue‐ and cell‐specific targeting. This review
Yu Han, Ying Wang, Xintao Gao, Yan Lei, Yantao Li, Zhiyong Tang   +5 more
wiley   +1 more source

Structural insights into Plasmodium PPIases

Frontiers in Cellular and Infection Microbiology, 2022
Malaria is one of the most prevalent infectious diseases posing a serious challenge over the years, mainly owing to the emergence of drug-resistant strains, sparking a need to explore and identify novel protein targets.
Sreekanth Rajan, Ho Sup Yoon, Ho Sup Yoon, Ho Sup Yoon   +3 more
doaj   +1 more source

Dickkopf-related protein 1 (Dkk1) regulates the accumulation and function of myeloid derived suppressor cells in cancer [PDF]

, 2016
Tumor–stroma interactions contribute to tumorigenesis. Tumor cells can educate the stroma at primary and distant sites to facilitate the recruitment of heterogeneous populations of immature myeloid cells, known as myeloid-derived suppressor cells (MDSCs).
Ali Zamani, Andrea Wang-Gillam, Aude-Hélène Capietto, Barcellos-Hoff, Biancamaria Ricci, Bindea, Capietto, David B. Bumpass, David G. DeNardo, Fowler, Gabitass, Gabrilovich, Gabrilovich, Galon, Hamanishi, Katherine Weilbaecher, Li, Liu, Lucia D’Amico, MacDonald, Mace, Mahmoud, Melissa Meyer, Mitchem, Mundy-Bosse, Pinzone, Porembka, Roberta Faccio, Räsänen, Sahil Mahajan, Schreiber, Sheila A. Stewart, Tian, Trikha, Weilbaecher, Xinming Su, Yaccoby, Yamabuki, Yang, Zhang, Zhang, Zheng, Zhengfeng Yang, Zhu   +43 more
core   +2 more sources