Results 1 to 10 of about 31,837 (203)
Suppression of Coronavirus Replication by Cyclophilin Inhibitors
Viruses, 2013 Coronaviruses infect a variety of mammalian and avian species and cause serious diseases in humans, cats, mice, and birds in the form of severe acute respiratory syndrome (SARS), feline infectious peritonitis (FIP), mouse hepatitis, and avian infectious ...
Takashi Sasaki, Sasaki Takashi
exaly +3 more sources
MoleculesCyclophilin A, a widely prevalent cellular protein, exhibits peptidyl-prolyl cis-trans isomerase activity. This protein is predominantly located in the cytosol; additionally, it can be secreted by the cells in response to inflammatory stimuli ...
Xuemei Zhao +3 more
exaly +3 more sources
Extracellular cyclophilins A and C induce dysfunction of pancreatic microendothelial cells
Frontiers in Physiology, 2022 Extracellular cyclophilins (eCyps) A and B are chemotactic mediators in several illnesses in which inflammation plays an important role such as diabetes and cardiovascular diseases.
Rebeca Alvariño +14 more
doaj +1 more source
Cells, 2020 Background: Marfan syndrome (MFS) is a genetic disease, characterized by thoracic aortic aneurysm (TAA), which treatment is to date purely surgical. Understanding of novel molecular targets is mandatory to unveil effective pharmacological approaches ...
Gianluca L. Perrucci +16 more
doaj +1 more source
口腔疾病防治, 2021 Cyclophilin A (CypA) is the first foldable enzyme in human cells that has peptidyl proliferase-trans isomerase activity and has a strong proinflammatory effect. CD147 can act as the signal receptor of CypA. The interaction of the two through cell-surface
YANG Ting, HUANG Shiguang
doaj +1 more source
Host cell species-specific effect of cyclosporine A on simian immunodeficiency virus replication
Retrovirology, 2012 Background An understanding of host cell factors that affect viral replication contributes to elucidation of the mechanism for determination of viral tropism.
Takeuchi Hiroaki +5 more
doaj +1 more source
Cyclophilins and cyclophilin inhibitors in nidovirus replication
Virology, 2018 Cyclophilins (Cyps) belong to the family of peptidyl-prolyl isomerases (PPIases). The PPIase activity of most Cyps is inhibited by the immunosuppressive drug cyclosporin A and several of its non-immunosuppressive analogs, which can also block the replication of nidoviruses (arteriviruses and coronaviruses).
Adriaan H. de Wilde +3 more
openaire +3 more sources
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
FEBS Letters, 1994 Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +2 more sources
Cyclophilin A: a novel biomarker for cardiovascular disease in patients with type 2 diabetes
The Egyptian Journal of Internal Medicine, 2019 Background and aims Type 2 diabetes mellitus (DM) is a strong independent risk factor for coronary heart disease. Cyclophilin A (CyPA) is a protein secreted from vascular smooth muscle cells in response to reactive oxygen species.
Manal M Hussain +3 more
doaj +1 more source
Pathogens, 2020 Bovine mastitis is the inflammatory reaction of the mammary gland and is commonly caused by bacterial infections in high-yielding dairy cows. The detailed investigation of the immunotranscriptomic response of bovine mammary epithelial (BME) cells to ...
Md. Aminul Islam +12 more
doaj +1 more source