Non‐Immunosuppressive Cyclophilin Inhibitors [PDF]
Angewandte Chemie International Edition, 2022 AbstractCyclophilins, enzymes with peptidyl‐prolyl cis/trans isomerase activity, are relevant to a large variety of biological processes. The most abundant member of this enzyme family, cyclophilin A, is the cellular receptor of the immunosuppressive drug cyclosporine A (CsA).
Cordelia Schiene‐Fischer +2 more
openaire +5 more sources
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
FEBS Letters, 1994 Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +3 more sources
Cyclophilin D in mitochondrial pathophysiology
Biochimica et Biophysica Acta (BBA) - Bioenergetics, 2010 Cyclophilins are a family of peptidyl-prolyl cis-trans isomerases whose enzymatic activity can be inhibited by cyclosporin A. Sixteen cyclophilins have been identified in humans, and cyclophilin D is a unique isoform that is imported into the mitochondrial matrix.
GIORGIO, VALENTINA +6 more
openaire +8 more sources
Cyclophilin B serum levels present variations across the menstrual cycle
Scientific Reports, 2023 Cyclophilins are a family of chaperones involved in inflammation and cell death. Cyclophilin B is released by inflammatory cells and acts through the receptor CD147, affecting matrix metalloproteases release, whilst cyclophilin D participates in hypoxia ...
Rebeca Alvariño +7 more
doaj +2 more sources
Stereo views of cocrystal structures of cyclophilins with cyclophilin inhibitors.pdf
, 2016 Cocrystal structures (stereo views of sections of the electron density maps) of cyclophilin D complexed with different compounds from a new family of nonpeptidic, small-molecule cyclophilin ...
Jean-Michel Pawlotsky +12 more
openaire +2 more sources
MoleculesCyclophilin A, a widely prevalent cellular protein, exhibits peptidyl-prolyl cis-trans isomerase activity. This protein is predominantly located in the cytosol; additionally, it can be secreted by the cells in response to inflammatory stimuli ...
Xuemei Zhao +3 more
doaj +2 more sources
Thermo‐kinetic analysis space expansion for cyclophilin‐ligand interactions – identification of a new nonpeptide inhibitor using Biacore™ T200 [PDF]
FEBS Open Bio, 2017 We have established a refined methodology for generating surface plasmon resonance sensor surfaces of recombinant his‐tagged human cyclophilin‐A. Our orientation‐specific stabilisation approach captures his‐tagged protein under ‘physiological conditions’
Martin A. Wear +4 more
doaj +2 more sources
Diagnostic Value of Cyclophilin A in Acute Ischemic Stroke [PDF]
Eurasian Journal of Emergency Medicine, 2017 Aim: The early diagnosis and treatment of patients presenting to the emergency department symptoms of stroke can significantly reduce mortality and morbidity rates associated with it.
Yunus Karaca +9 more
doaj +3 more sources
Cyclophilin A Isomerisation of Septin 2 Mediates Abscission during Cytokinesis
, 2023 International audienceThe isomerase activity of Cyclophilin A is important for midbody abscission during cell division, however, to date, midbody substrates remain unknown.
Mc Gee, Margaret, M +15 more
core +2 more sources
s-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin [PDF]
, 1992 Cyclophilins (cyclosporin A-binding proteins) are conserved, ubiquitous, and abundant proteins that accelerate the isomerization of XaaPro peptide bonds and the refolding of proteins in vitro.
Arber, S. +6 more
core +1 more source