Results 131 to 140 of about 57,467,955 (246)
, 2014 The long-term use of central venous catheters for delivering nutrients and drugs in preterm neonates has been related to nosocomial infections. The majority of late-onset sepsis in very preterm infants (The major host defense peptide LL-37 is the only ...
Eva Kis Danielne Hell (18652690)
core +1 more source
Bactericidal and hemolytic properties of mixed LL-37/surfactant systems
, 2007 The interaction between acyl chain homologues (C10 and C12) of n-acyl β-D-maltoside and the antimicrobial peptide LL-37 ([LL-37, 37 aa]) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for
Malmsten, Martin, +2 more
core +2 more sources
Membrane Core-Specific Antimicrobial Action of Cathelicidin LL-37 Peptide Switches Between Pore and Nanofibre Formation. [PDF]
Sci Rep, 2016 Shahmiri M +5 more
europepmc +1 more source
PROTEOMICS, EarlyView.ABSTRACT Multiple sclerosis and neuromyelitis optica spectrum disorder (NMOSD) are inflammatory demyelinating diseases of the CNS whose diagnosis is mainly based on clinical evidence, magnetic resonance imaging, and the analysis of cerebrospinal fluid (CSF). Current approaches provide only partial insight into disease‐related biological processes, thus
Cristina Contini +9 more
wiley +1 more source
Actin enables the antimicrobial action of LL-37 peptide in the presence of microbial proteases. [PDF]
J Biol Chem, 2014 Sol A +7 more
europepmc +1 more source
Proteomic Analysis of ARF1‐ and ARF3‐Proximal Proteins at the Trans‐Golgi Network
PROTEOMICS, EarlyView.ABSTRACT Despite its fundamental importance, the molecular mechanisms of post‐Golgi transport remain incompletely understood. Carrier formation of post‐Golgi transport depends on ARF3 and ARF1, very close paralogs; the former localizes on the trans‐Golgi network (TGN) whereas the latter localizes on TGN and cis‐Golgi.
Taisei Uehara +3 more
wiley +1 more source
Molecular Interactions of Viral Insulin/IGF‐Like Peptides With Zebrafish Receptors
Proteins: Structure, Function, and Bioinformatics, EarlyView.ABSTRACT Signaling through the insulin receptor (IR) and the type 1 insulin‐like growth factor receptor (IGF1R) is modulated by secreted hormones and growth factor ligands (e.g., insulin and insulin‐like growth factor 1, IGF1). Impaired signaling in these receptors often leads to diabetes and oncogenic diseases.
Lev Levintov, Harish Vashisth
wiley +1 more source
Proteins: Structure, Function, and Bioinformatics, EarlyView.ABSTRACT Allosteric communication is fundamental to the function of proteins, but identifying the residue‐level pathways through which signals travel and their directionality is still a major challenge. Here we present a multi‐metric information‐theoretic framework that identifies candidate allosteric communication pathways from a single protein ...
Aysima Hacisuleyman, Dirk Fasshauer
wiley +1 more source
Proteins: Structure, Function, and Bioinformatics, EarlyView.ABSTRACT Predicted protein structures now enable fold discovery beyond the reach of sequence homology, but scalable and interpretable methods remain limited. We present Cooper‐Beta, a resource‐efficient, chain‐resolved framework for detecting β‐barrel‐like folds from strand connectivity.
Shuyu Zhong, Yuying Jiang
wiley +1 more source
Pest Management Science, EarlyView.Host‐induced gene silencing of the effector candidate Minc09294 significantly impairs Meloidogyne incognita parasitism, markedly reducing gall formation, reproduction, and the development of specialized giant cells, with partial cross‐species effects on M.
João Pedro Abreu‐Sousa +16 more
wiley +1 more source