Results 91 to 100 of about 5,869 (218)

Judaism, Philo, and Hegel's Theology

open access: yesModern Theology, EarlyView.
Abstract Hegel displays consistent interest in Judaism, but his presentation seems to differ widely between his earlier and later writings. Contemporary scholarly interpretations of this apparent change also differ widely. In this article, I present the interpretive problem as one of continuity‐discontinuity, and place the major scholarly treatments ...
Reed Frey, C.O.
wiley   +1 more source

Middlebrow Aesthetics: An Explanation and Defense

open access: yesPacific Philosophical Quarterly, EarlyView.
ABSTRACT We offer a philosophical account of the middlebrow as a theoretical category to do explanatory and critical work in aesthetics. On our account, the middlebrow ought to be understood as aspirational popular art. That is, it is art which aspires both to be popular (in a distinctive sense), and at the same time to be something more than popular ...
Aaron Meskin, Jonathan M. Weinberg
wiley   +1 more source

The Dual Prey-Inactivation Strategy of Spiders—In-Depth Venomic Analysis of Cupiennius salei

open access: yesToxins, 2019
Most knowledge of spider venom concerns neurotoxins acting on ion channels, whereas proteins and their significance for the envenomation process are neglected.
Lucia Kuhn-Nentwig   +4 more
doaj   +1 more source

Regulating Autonomous Weapon Systems: Searching for African Solutions to Regional and Global Problems

open access: yesRegulation &Governance, EarlyView.
ABSTRACT Lethal autonomous weapon systems (LAWS), while offering strategic advantages in warfare, pose significant ethical, legal, and security risks, especially for countries in the Global South. This article examines how a philosophical perspective, rooted in African ethical and political thought, can enrich regional and global debates on regulating ...
Ezenwa E. Olumba   +3 more
wiley   +1 more source

Obesity and the Politics of Taddeo di Bartolo's Inferno

open access: yesRenaissance Studies, EarlyView.
ABSTRACT This paper examines Taddeo di Bartolo's depiction of Hell in the Collegiata di Santa Maria Assunta, the mother church of San Gimignano. In a striking departure from similar scenes of the period, the fresco, painted in the early fifteenth century, emphasizes the obesity of the sinners—suggesting a deliberate visual critique.
Stefania Roccas Gandal
wiley   +1 more source

Venomic and pharmacological activity of Acanthoscurria paulensis (Theraphosidae) spider venom

open access: yesToxicon, 2013
In the present study we conducted proteomic and pharmacological characterizations of the venom extracted from the Brazilian tarantula Acanthoscurria paulensis, and evaluated the cardiotoxicity of its two main fractions. The molecular masses of the venom components were identified by mass spectrometry (MALDI-TOF-MS) after chromatographic separation ...
Mourão, Caroline Barbosa F.   +11 more
openaire   +2 more sources

Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase

open access: yes, 2007
The definitive version is available at www.blackwell-synergy.comCupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity.
Bowie, J.   +13 more
core   +1 more source

Structure–Function and Therapeutic Potential of Spider Venom-Derived Cysteine Knot Peptides Targeting Sodium Channels

open access: yesFrontiers in Pharmacology, 2019
Spider venom-derived cysteine knot peptides are a mega-diverse class of molecules that exhibit unique pharmacological properties to modulate key membrane protein targets.
Fernanda C. Cardoso, Richard J. Lewis
doaj   +1 more source

What No Research Means: The Problematic of Time and Possibilities for Expansiveness in Interpretive Literacy Research

open access: yesReading Research Quarterly, Volume 61, Issue 3, July/August/September 2026.
ABSTRACT This article examines what becomes possible for interpretive literacy research when time is treated not as a neutral backdrop but as a central problematic. We argue that research does not merely trace temporal sequences; it actively creates temporalities that shape what becomes sensible, thinkable, and sayable within literacy studies.
Gail Boldt, Kevin Leander
wiley   +1 more source

Sharing conspiracy theories and staying in power: How leaders' false theories influence leadership perception

open access: yesBritish Journal of Social Psychology, Volume 65, Issue 3, July 2026.
Abstract Research shows that spreading conspiracy theories impacts leaders' reputations; yet, it remains unclear how leaders are viewed when their theories are debunked. Across four studies (N = 1437), we explored whether conveying a conspiracy theory, regardless of its accuracy, influences followers' impressions of leader dominance, competence and ...
Shen Cao   +2 more
wiley   +1 more source

Home - About - Disclaimer - Privacy