Results 11 to 20 of about 31,862 (193)
Cyclophilins as Modulators of Viral Replication [PDF]
Viruses, 2013 Cyclophilins are peptidyl‐prolyl cis/trans isomerases important in the proper folding of certain proteins. Mounting evidence supports varied roles of cyclophilins, either positive or negative, in the life cycles of diverse viruses, but the nature and ...
Stephen D. Frausto +2 more
doaj +3 more sources
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
FEBS Letters, 1994 Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +2 more sources
Cyclophilins and cyclophilin inhibitors in nidovirus replication
Virology, 2018 Cyclophilins (Cyps) belong to the family of peptidyl-prolyl isomerases (PPIases). The PPIase activity of most Cyps is inhibited by the immunosuppressive drug cyclosporin A and several of its non-immunosuppressive analogs, which can also block the replication of nidoviruses (arteriviruses and coronaviruses).
Adriaan H. de Wilde +3 more
openaire +3 more sources
Non‐Immunosuppressive Cyclophilin Inhibitors
Angewandte Chemie International Edition, 2022 AbstractCyclophilins, enzymes with peptidyl‐prolyl cis/trans isomerase activity, are relevant to a large variety of biological processes. The most abundant member of this enzyme family, cyclophilin A, is the cellular receptor of the immunosuppressive drug cyclosporine A (CsA).
Cordelia Schiene‐Fischer +2 more
openaire +4 more sources
Gene Therapy Strategies to Exploit TRIM Derived Restriction Factors against HIV-1
Viruses, 2014 Restriction factors are a collection of antiviral proteins that form an important aspect of the innate immune system. Their constitutive expression allows immediate response to viral infection, ahead of other innate or adaptive immune responses.
Emma Chan, Greg J. Towers, Waseem Qasim
doaj +1 more source
Cyclophilin A‐mediated mitigation of coronavirus SARS‐CoV‐2
Bioengineering & Translational Medicine, 2023 Human cyclophilin A (hCypA) is important for the replication of multiple coronaviruses (CoVs), and cyclosporine A inhibitors can suppress CoVs. The emergence of rapidly spreading severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) variants has ...
Simranjeet Singh Sekhon +8 more
doaj +1 more source
Science-Business eXchange, 2011 In vitro studies suggest cyclosporine A derivatives could help treat coronaviruses such as SARS.
openaire +1 more source
Biotechnology & Biotechnological Equipment, 2019 The aim of this study was to investigate the effects of cyclophilin B on MC3T3-E1 cells and the underlying mechanism. CCK-8 assay was used to evaluate the cell activity, polymerase chain reaction to verify the overexpression of cyclophilin B, western ...
Fan Mei, Yanhong Tu
doaj +1 more source
Genome-Wide Analysis of Cyclophilin Proteins in 21 Oomycetes
Pathogens, 2019 Cyclophilins (CYPs), a highly-conserved family of proteins, belong to a subgroup of immunophilins. Ubiquitous in eukaryotes and prokaryotes, CYPs have peptidyl-prolyl cis−trans isomerase (PPIase) activity and have been implicated as virulence ...
Yan Zhang +4 more
doaj +1 more source
BMC Genomics, 2022 Background Cyclophilin (CYP) belongs to the immunophilin family and has peptidyl-prolyl cis-trans isomerase (PPIase) activity, which catalyzes the cis-trans isomerization process of proline residues.
Zhi-Wen Qiao +4 more
doaj +1 more source