Results 71 to 80 of about 355,998 (353)

Degradation mechanism of the von Willebrand factor A2 domain by nattokinase

FEBS Letters, EarlyView.
Nattokinase, a natto‐derived protease, exhibits potent antithrombotic effects. This study demonstrates that nattokinase directly cleaves the von Willebrand factor (vWF) A2 domain in vitro. Unlike the native regulator ADAMTS13, nattokinase degrades folded vWF independently of shear stress.
Ryuichi Hyakumoto, Masatomo So, Ayako Furukawa, Kenji Sugase   +3 more
wiley   +1 more source

Comparative evaluation of the synthesis and purification of transmembrane peptide fragments - Rat bradykinin receptor fragment 64-97 as model

, 1997
The 34-residue peptide CTVAEIYLGNLAGADLILASGLPFWAITIANNFD (TM-34), corresponding to the 64-97 sequence of the rat bradykinin receptor, was selected as a model of hydrophobic transmembrane peptide segment for systematic study of synthesis and purification
Andreu, D., Miranda, A., Albericio, F., Paiva, ACM, Nakaie, C. R., Oliveira, E., Tominaga, M.   +6 more
core   +1 more source

Dammarenediol II enhances etoposide‐induced apoptosis by targeting O‐GlcNAc transferase and Akt/GSK3β/mTOR signaling in liver cancer

Molecular Oncology, Volume 20, Issue 6, Page 1591-1611, June 2026.
Etoposide induces DNA damage, activating p53‐dependent apoptosis via caspase‐3/7, which cleaves PARP1. Dammarenediol II enhances this apoptotic pathway by suppressing O‐GlcNAc transferase activity, further decreasing O‐GlcNAcylation. The reduction in O‐GlcNAc levels boosts p53‐driven apoptosis and influences the Akt/GSK3β/mTOR signaling pathway ...
Jaehoon Lee, Byung‐Cheol Han, Gi‐Bang Koo, Jihye Park, Mijin Kwon, Young Bin Park, Jae‐Mun Choi, Seung‐Ho Lee, Sangho Roh   +8 more
wiley   +1 more source

Structural identification of electron transfer dissociation products in mass spectrometry using infrared ion spectroscopy

Nature Communications, 2016
Mass spectrometry is a leading method used for sequencing peptides and proteins by fragmentation followed by analysis of the sequence fragments. Here, the authors use infrared spectroscopy to characterize the structures of peptide fragments formed during
Jonathan Martens, Josipa Grzetic, Giel Berden, Jos Oomens   +3 more
doaj   +1 more source

Effect of apolipoprotein C-I peptides on the apolipoprotein E content and receptor-binding properties of beta-migrating very low density lipoproteins.

Journal of Lipid Research, 1994
To evaluate the role of apolipoprotein (apo) C-I in inhibiting lipoprotein binding to the low density lipoprotein receptor-related protein (LRP), a putative lipoprotein remnant receptor, apoC-peptide fragments were prepared by chemical synthesis or by ...
J B Swaney, K H Weisgraber
doaj   +1 more source

Determining the Hydrophobicity Index of Protected Amino Acids and Common Protecting Groups

Separations, 2023
Peptides are in great demand in the pharmaceutical arena and a majority of these peptides contain 20 or more amino acids. They are infrequently synthesised using the fragment condensation approach. A key limitation in adopting this approach more commonly
Varshitha Gavva, Othman Al Musaimi, Colin Bent, Daryl R. Williams   +3 more
doaj   +1 more source

SAMPI: protein identification with mass spectra alignments

, 2007
Kaltenbach H-M, Wilke A, Böcker S. SAMPI: protein identification with mass spectra alignments. BMC Bioinformatics. 2007;8(1): 102.Background: Mass spectrometry based peptide mass fingerprints (PMFs) offer a fast, efficient, and robust method for protein ...
Sebastian Böcker, Kaltenbach Hans-Michael, Wilke Andreas, Hans-Michael Kaltenbach, Andreas Wilke, Wilke, Andreas, Kaltenbach, Hans-Michael, Böcker, Sebastian, Böcker Sebastian   +8 more
core   +1 more source

Identification of serum protein biomarkers for pre‐cancerous lesions associated with pancreatic ductal adenocarcinoma

Molecular Oncology, Volume 20, Issue 6, Page 1473-1493, June 2026.
This work identified serum proteins associated with pancreatic epithelial neoplasms (PanINs) and early‐stage PDAC. Proteomics screens assessed genetically engineered mice with abundant PanINs, KPC mice (Lox‐STOP‐Lox‐KrasG12D/+ Lox‐STOP‐Lox‐Trp53R172H/+ Pdx1‐Cre) before PDAC development and also early‐stage PDAC patients (n = 31), compared to benign ...
Hannah Mearns, Jaclyn S. Long, Sergio Lilla, Kelly Hodge, Marcus J. G. W. Ladds, Colin Nixon, Paula Fernández‐Palanca, Sara Zanivan, Pilar Acedo, Stephen P. Pereira, Kevin M. Ryan   +10 more
wiley   +1 more source

SYNTHESIS OF OLIGOPEPTIDES OF DEFINED FRAGMENT COMPOSITION [PDF]

Journal of IMAB, 2011
The advantages of the solid-phase peptide synthesis were used. The peptide chain was built on specially processed insoluble polymer resin: Wang- and Rink Amide MBHA-resin.
Tamara Paypanova, Tatyana Hristova, Rumyana Cherkezova   +2 more
doaj  

Self-Assembly and Hydrogelation of an Amyloid Peptide Fragment

Biochemistry, 2008
The self-assembly of a fragment of the amyloid beta peptide that has been shown to be critical in amyloid fibrillization has been studied in aqueous solution. There are conflicting reports in the literature on the fibrillization of Abeta (16-20), i.e., KLVFF, and our results shed light on this.
Krysmann, M.J., Castelletto, V., Kelarakis, A., Hamley, I.W., Hule, R.A., Pochan, D.J.   +5 more
openaire   +3 more sources