Results 31 to 40 of about 4,905,249 (270)

Single-Cell RNA Sequencing Resolves Molecular Relationships Among Individual Plant Cells1[OPEN]

Plant Physiology, 2019
High-throughput single-cell RNA sequencing of Arabidopsis root protoplasts demonstrates the feasibility and utility of individual cell transcriptomic analyses in plants.
K. Ryu, Ling Huang, H. Kang, J. Schiefelbein   +3 more
semanticscholar   +1 more source

RNA methylation in plants: An overview

Frontiers in Plant Science, 2023
RNA methylation is an important post-transcriptional modification that influences gene regulation. Over 200 different types of RNA modifications have been identified in plants.
Harshraj Shinde, Ambika Dudhate, Ulhas S. Kadam, Jong Chan Hong, Jong Chan Hong   +4 more
doaj   +1 more source

Computer-assisted assignment of functional domains in the nonstructural polyprotein of hepatitis E virus: delineation of an additional group of positive-strand RNA plant and animal viruses.

Proceedings of the National Academy of Sciences of the United States of America, 1992
Computer-assisted comparison of the nonstructural polyprotein of hepatitis E virus (HEV) with proteins of other positive-strand RNA viruses allowed the identification of the following putative functional domains: (i) RNA-dependent RNA polymerase, (ii ...
E. Koonin, Alexander E. GORBALENYAt, M. Purdy, M. Rozanov, Gregory R. Reyes, A. D. W. Bradley, Sherman M. Weissman, BNYVV LLSWDFHTPH.ALDVTGKQI IFVDEFTAYDWRLLAVLAYRNHAHTIYLVGDEQQTCIQEGRGEGISILNK   +7 more
semanticscholar   +1 more source

Investigation of temperature stress tolerance in Arabidopsis STTM165/166 using electrophysiology and RNA-Seq [PDF]

arXiv, 2023
Plant electrical signals have been shown to be generated in response to various environmental stresses, but the relationship between these signals and stress tolerance is not well understood. In this study, we used the Arabidopsis STTM165/166 mutant, which exhibits enhanced temperature tolerance, to examine this relationship.
arxiv  

Light-Dependent Translation Change of Arabidopsis psbA Correlates with RNA Structure Alterations at the Translation Initiation Region

Cells, 2021
mRNA secondary structure influences translation. Proteins that modulate the mRNA secondary structure around the translation initiation region may regulate translation in plastids.
Piotr Gawroński, Christel Enroth, Peter Kindgren, Sebastian Marquardt, Stanisław Karpiński, Dario Leister, Poul Erik Jensen, Jeppe Vinther, Lars B. Scharff   +8 more
doaj   +1 more source

Sindbis virus proteins nsP1 and nsP2 contain homology to nonstructural proteins from several RNA plant viruses

Journal of Virology, 1985
Although the genetic organization of tobacco mosaic virus (TMV) differs considerably from that of the tripartite viruses (alfalfa mosaic virus [AlMV] and brome mosaic virus [BMV]), all of these RNA plant viruses share three domains of homology among ...
P. Ahlquist, E. G. Strauss, C. Rice, J. H. Strauss, J. Haseloff, D. Zimmern   +5 more
semanticscholar   +1 more source

In silico ADMET and molecular docking study on searching potential inhibitors from limonoids and triterpenoids for COVID-19 [PDF]

, 2020
Virtual screening of phytochemicals was performed through molecular docking, simulation, in silico ADMET and drug-likeness prediction to identify the potential hits that can inhibit the effects of SARS-CoV-2. Considering the published literature on medicinal importance, total 154 phytochemicals with analogous structure from limonoids and triterpenoids ...
arxiv   +1 more source

Evolutionary relationship between luteoviruses and other RNA plant viruses based on sequence motifs in their putative RNA polymerases and nucleic acid helicases.

Nucleic Acids Research, 1989
Comparative studies of sequence motifs in the RNA polymerases and nucleic acid helicases of positive-sense RNA plant viruses have provided a new scheme for the classification of these pathogens.
N. Habili, R. Symons
semanticscholar   +1 more source

Rice Yellow Mottle Virus, an RNA Plant Virus, Evolves as Rapidly as Most RNA Animal Viruses

Journal of Virology, 2008
The rate of evolution of an RNA plant virus has never been estimated using temporally spaced sequence data, by contrast to the information available on an increasing range of animal viruses.
Denis Fargette, A. Pinel, M. Rakotomalala, E. Sangu, O. Traoré, D. Sérémé, F. Sorho, S. Issaka, E. Hébrard, Y. Séré, Z. Kanyeka, G. Konaté   +11 more
semanticscholar   +1 more source

DNA methylation is maintained with high fidelity in the honey bee germline and exhibits global non-functional fluctuations during somatic development

Epigenetics & Chromatin, 2019
Background DNA methylation of active genes, also known as gene body methylation, is found in many animal and plant genomes. Despite this, the transcriptional and developmental role of such methylation remains poorly understood.
Keith D. Harris, James P. B. Lloyd, Katherine Domb, Daniel Zilberman, Assaf Zemach   +4 more
doaj   +1 more source