Results 31 to 40 of about 187,700 (310)

Orthobunyavirus ultrastructure and the curious tripodal glycoprotein spike [PDF]

, 2013
The genus <i>Orthobunyavirus</i> within the family <i>Bunyaviridae</i> constitutes an expanding group of emerging viruses, which threaten human and animal health.
McLees, A., Huiskonen, JT, Yeromonahos, C, Christelle Yeromonahos (413081), Juha T. Huiskonen (191734), David Bitto, David Bitto (413079), Bowden, Thomas A, Elliott, RM, Elliott, Richard M., Richard M. Elliott (252934), Elliott, Richard, Bowden Thomas A., McLees, A, Yeromonahos, Christelle, Huiskonen, Juha T., Angela McLees (413080), Elliott, Richard M, Christelle Yeromonahos, Pierson, Ted, Huiskonen, J.T., Elliott, R.M., Huiskonen, Juha, Richard M Elliott, McLees, Angela, Bowden, T.A., Bitto, David, Bitto David, Bitto, D, Huiskonen, Juha T, Elliott Richard M., Bowden, Thomas A., Thomas A. Bowden (413078), McLees Angela, Bitto, D., Bowden, Thomas, Huiskonen Juha T., Angela McLees, Bowden, TA, Yeromonahos, C., Thomas A Bowden, Yeromonahos Christelle, Juha T Huiskonen   +42 more
core   +1 more source

Efficient production of foot-and-mouth disease virus empty capsids in insect cells following down regulation of 3C protease activity [PDF]

, 2013
Foot-and-mouth disease virus (FMDV) is a significant economically and distributed globally pathogen of Artiodactyla. Current vaccines are chemically inactivated whole virus particles that require large-scale virus growth in strict bio-containment with ...
Owens, Ray, Paramasivam, S, Kotecha, A, Wilsden, G, Parida, Satya, Paton, David, Ren, Junyuan, Al-Khalil, Tara, Belsham, Graham J., Lomonossoff, GP, Li, Yanmin, Belsham, GJ, Loureiro, S, Kotecha, Abhay, Belsham, Graham, Owens, R, Stuart, David I, Lomonossoff, George P., Porta, C, Xu, X, Parida, S, Lomonossoff, George P, Burman, Alison, Paton, D, Jones, IM, Curry, S, Blesham, Graham J., Paramasivam, Saravanan, Xu, Xiaodong, Stuart, DI, Charleston, Bryan, Jackson, T, Charleston, B, Burman, A, Jones, Ian M., Porta, Claudine, Ren, J, Stuart, David I., Fry, E, Stuart, David, Jones, Ian M, Ferris, N, Ferris, Nigel, Loureiro, Silvia, Belsham, Graham J, Curry, Stephen, Jackson, Terry, Al-Khalil, T, Li, Y, Fry, Elizabeth, Wilsden, Ginette   +50 more
core   +1 more source

Virus-like particle vaccine protects against 2009 H1N1 pandemic influenza virus in mice. [PDF]

PLoS ONE, 2010
The 2009 influenza pandemic and shortages in vaccine supplies worldwide underscore the need for new approaches to develop more effective vaccines.We generated influenza virus-like particles (VLPs) containing proteins derived from the A/California/04/2009
Fu-Shi Quan, Aswani Vunnava, Richard W Compans, Sang-Moo Kang   +3 more
doaj   +1 more source

Activation of the beta interferon promoter by paramyxoviruses in the absence of virus protein synthesis [PDF]

, 2012
Conflicting reports exist regarding the requirement for virus replication in interferon (IFN) induction by paramyxoviruses. Our previous work has demonstrated that pathogen-associated molecular patterns capable of activating the IFN-induction cascade are
Killip, M. J., Randall, RE, Goodbourn, S., Precious, BL, Young, D. F., Precious, B. L., Randall, R. E., S. Goodbourn, Goodbourn, S, D. F. Young, R. E. Randall, M. J. Killip, Young, DF, Killip, MJ, B. L. Precious   +14 more
core   +1 more source

Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles [PDF]

, 2021
In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]).
Browning, Kathryn L., Jørgensen, Elin,, Li, Xiaomin,, Skoda, Maximilian W.A.,, Li, Xiaomin, Zhao, Dongyuan, Browning, Kathryn L, Berti, D., Malmsten, Martin, Skoda, Maximilian WA, Häffner, Sara Malekkhaiat, Montis, C., Skoda, Maximilian W A, Montis, Costanza, Berti, Debora, Browning, Kathryn L.,, Berti, Debora,, Zhao, Dongyuan,, Häffner, Sara Malekkhaiat,, Jørgensen, Elin, Skoda, Maximilian W.A., Malmsten, Martin,, Parra-Ortiz, Elisa,, Parra-Ortiz, Elisa, Lund University., Montis, Costanza,   +25 more
core   +1 more source

Escherichia coli-derived virus-like particles in vaccine development

npj Vaccines, 2017
Recombinant virus-like particle-based vaccines are composed of viral structural proteins and mimic authentic native viruses but are devoid of viral genetic materials. They are the active components in highly safe and effective vaccines for the prevention
Xiaofen Huang, Xin Wang, Jun Zhang, Ningshao Xia, Qinjian Zhao   +4 more
doaj   +1 more source

Virus-like particle-mediated intracellular delivery of mRNA cap analog with in vivo activity against hepatocellular carcinoma. [PDF]

, 2014
UNLABELLED Adenovirus dodecahedron (Dd), a nanoparticulate proteinaceous biodegradable virus-like particle (VLP), was used as a vector for delivery of an oncogene inhibitor to hepatocellular carcinoma (HCC) rat orthotopic model.
Kowalska, Joanna, Piguet, Anne Christine, Piguet, Anne-Christine, Zochowska, Monika, Szolajska, Ewa, Chroboczek, Jadwiga, Jemielity, Jacek, Dufour, Jean-François   +7 more
core   +2 more sources

Hepatitis B Virus (HBV) Subviral Particles as Protective Vaccines and Vaccine Platforms

Viruses, 2020
Hepatitis B remains one of the major global health problems more than 40 years after the identification of human hepatitis B virus (HBV) as the causative agent.
Joan Kha-Tu Ho, Beena Jeevan-Raj, Hans-Jürgen Netter   +2 more
doaj   +1 more source

Multiplex Human Papillomavirus L1L2 virus-like particle antibody binding assay

MethodsX, 2022
A variety of in vitro techniques are available to estimate the level of antibodies present in human serum samples. Such tests are highly specific and are used to determine prior exposure to a pathogen or to estimate the magnitude, breadth and durability ...
Kavita Panwar, Anna Godi, Clementina E. Cocuzza, Nick Andrews, Jo Southern, Paul Turner, Elizabeth Miller, Simon Beddows   +7 more
doaj   +1 more source

The structural basis for the integrity of adenovirus Ad3 dodecahedron [PDF]

, 2012
During the viral life cycle adenoviruses produce excess capsid proteins. Human adenovirus serotype 3 (Ad3) synthesizes predominantly an excess of free pentons, the complexes of pentameric penton base and trimeric fiber proteins, which are responsible for
Fender, Pascal, Monika Zochowska (134637), Jean-Pierre Andrieu, Ewa Szolajska (134629), Stephen Cusack (134664), Burmeister, Wim P, Pascal Fender (132764), Szolajska, Ewa, Pascal Fender, Nerlo, Barbara, Burmeister, Wim P., Igor Andreev, Wim P. Burmeister (134634), Wim P Burmeister, Guy Schoehn, Jadwiga Chroboczek (134668), Andreev, Igor, Naskalska, Antonina, Stephen Cusack, Chroboczek, Jadwiga, Barbara Nerlo (134643), Ewa Szolajska, Chloe Zubieta (134662), Barbara Nerlo, Igor Andreev (134649), Andrieu, Jean-Pierre, Jadwiga Chroboczek, Chloe Zubieta, Monika Zochowska, Zochowska, Monika, Cusack, Stephen, Jean-Pierre Andrieu (134655), Schoehn, Guy, Antonina Naskalska, Guy Schoehn (27525), Zubieta, Chloe, Antonina Naskalska (134660)   +36 more
core   +1 more source