Cyclophilins as Modulators of Viral Replication [PDF]
Viruses, 2013 Cyclophilins are peptidyl‐prolyl cis/trans isomerases important in the proper folding of certain proteins. Mounting evidence supports varied roles of cyclophilins, either positive or negative, in the life cycles of diverse viruses, but the nature and ...
Stephen D. Frausto +2 more
doaj +4 more sources
Structural and Functional Characterization of a Novel Family of Cyclophilins, the AquaCyps. [PDF]
PLoS ONE, 2016 Cyclophilins are ubiquitous cis-trans-prolyl isomerases (PPIases) found in all kingdoms of life. Here, we identify a novel family of cyclophilins, termed AquaCyps, which specifically occurs in marine Alphaproteobacteria, but not in related terrestric ...
Roman P Jakob +4 more
doaj +3 more sources
Mycobacterium tuberculosis cyclophilin A uses novel signal sequence for secretion and mimics eukaryotic cyclophilins for interaction with host protein repertoire. [PDF]
PLoS ONE, 2014 Cyclophilins are prolyl isomerases with multitude of functions in different cellular processes and pathological conditions. Cyclophilin A (PpiA) of Mycobacterium tuberculosis is secreted during infection in intraphagosomal niche.
Asani Bhaduri +10 more
doaj +2 more sources
Inhibition of cyclophilins alters lipid trafficking and blocks hepatitis C virus secretion [PDF]
Virology Journal, 2011 Host cyclophilin (cyp) inhibitors, such as NIM811, efficiently inhibit replication of hepatitis C virus (HCV) and have shown significant promise in recent clinical trials for the treatment of chronic HCV. It is therefore important to fully understand the
Compton Teresa +3 more
doaj +3 more sources
Target cell cyclophilins facilitate human papillomavirus type 16 infection. [PDF]
PLoS Pathogens, 2009 Following attachment to primary receptor heparan sulfate proteoglycans (HSPG), human papillomavirus type 16 (HPV16) particles undergo conformational changes affecting the major and minor capsid proteins, L1 and L2, respectively.
Malgorzata Bienkowska-Haba +2 more
doaj +2 more sources
Versatility of Cyclophilins in Plant Growth and Survival: A Case Study in Arabidopsis
Biomolecules, 2019 Cyclophilins (CYPs) belong to a peptidyl-prolyl cis-trans isomerase family, and were first characterized in mammals as a target of an immunosuppressive drug, cyclosporin A, preventing proinflammatory cytokine production.
Izailda Barbosa dos Santos +1 more
doaj +2 more sources
Conserved Conformational Dynamics Reveal a Key Dynamic Residue in the Gatekeeper Loop of Human Cyclophilins. [PDF]
J Phys Chem B, 2023 Cyclophilins are ubiquitous human enzymes that catalyze peptidyl-prolyl cis–trans isomerization in protein substrates. Of the 17 unique isoforms, five closely related isoforms (CypA–E) are found in various environments and participate in diverse cellular
Ahmed F, Yao XQ, Hamelberg D.
europepmc +2 more sources
Structural Basis for Cyclosporin Isoform-Specific Inhibition of Cyclophilins from Toxoplasma gondii [PDF]
, 2023 Cyclosporin (CsA) has antiparasite activity against the human pathogen Toxoplasma gondii. A possible mechanism of action involves CsA binding to T. gondii cyclophilins, although much remains to be understood.
Eva Jiménez-Faraco +18 more
core +1 more source
Plant Cyclophilins: Multifaceted Proteins With Versatile Roles
Frontiers in Plant Science, 2020 Cyclophilins constitute a family of ubiquitous proteins that bind cyclosporin A (CsA), an immunosuppressant drug. Several of these proteins possess peptidyl-prolyl cis-trans isomerase (PPIase) activity that catalyzes the cis-trans isomerization of the ...
Harpreet Singh +6 more
doaj +1 more source
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
FEBS Letters, 1994 Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +2 more sources