Results 21 to 30 of about 7,857 (174)

The Role of Cyclophilins in Inflammatory Bowel Disease and Colorectal Cancer

International Journal on Biological Sciences, 2021
Cyclophilins (Cyps) is a kind of ubiquitous protein family in organisms, which has biological functions such as promoting intracellular protein folding and participating in the pathological processes of inflammation and tumor. Inflammatory bowel disease (
Lifang Liang, Rong-Jaan Lin, Ying Xie, huaqing lin, Fangyuan Shao, W. Rui, Hongyuan Chen   +6 more
semanticscholar   +1 more source

Binding of the transcription factor MYC2-like to the ABRE of the OsCYP2 promoter enhances salt tolerance in Oryza sativa

PLoS ONE, 2022
Cyclophilins, a type of peptidyl-prolyl cis-trans isomerase, function as important molecular chaperones in a series of biological processes. However, the expression pattern and signal transduction pathway of cyclophilins are still unclear.
Hongbo Liu, Peng Cui, Bingxin Zhang, Jinbo Zhu, Cui Liu, Qingyang Li   +5 more
doaj   +3 more sources

An Overview of Cyclophilins in Human Cancers

Journal of International Medical Research, 2010
J. Lee, Ssang-Young Kim
exaly   +2 more sources

Blocking Cyclophilins in the Chronic Phase of Asthma Reduces the Persistence of Leukocytes and Disease Reactivation

American Journal of Respiratory Cell and Molecular Biology, 2011
Michael Bukrinsky, Rosalyn A Jurjus, Stephanie L Constant   +2 more
exaly   +2 more sources

Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]

FEBS Letters, 1994
Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire   +2 more sources

A Functional Analysis of the Cyclophilin Repertoire in the Protozoan Parasite Trypanosoma Cruzi

Biomolecules, 2018
Trypanosoma cruzi is the etiological agent of Chagas disease. It affects eight million people worldwide and can be spread by several routes, such as vectorborne transmission in endemic areas and congenitally, and is also important in non-endemic regions ...
Alina E. Perrone, Natalia Milduberger, Alicia G. Fuchs, Patricia L. Bustos, Jacqueline Bua   +4 more
doaj   +1 more source

CAQ Corner: Basic concepts of transplant immunology

, 2022
Liver Transplantation, EarlyView.
Amanda Cheung, Josh Levitsky
wiley   +1 more source

Cyclophilin [PDF]

Science-Business eXchange, 2011
In vitro studies suggest cyclosporine A derivatives could help treat coronaviruses such as SARS.
openaire   +1 more source

Non‐Immunosuppressive Cyclophilin Inhibitors

Angewandte Chemie International Edition, 2022
AbstractCyclophilins, enzymes with peptidyl‐prolyl cis/trans isomerase activity, are relevant to a large variety of biological processes. The most abundant member of this enzyme family, cyclophilin A, is the cellular receptor of the immunosuppressive drug cyclosporine A (CsA).
Cordelia Schiene‐Fischer, Gunter Fischer, Manfred Braun   +2 more
openaire   +4 more sources

Theileria annulata Cyclophilin1 (TaCyp1) Interacts With Host Cell MED21

Frontiers in Microbiology, 2018
Host cells infected by Theileria annulata schizonts show the character of permanent proliferation in vitro, also named transformation. To explore the molecular mechanism a T.
Shuaiyang Zhao, Junlong Liu, Guiquan Guan, Aihong Liu, Youquan Li, Hong Yin, Hong Yin, Jianxun Luo, Jianxun Luo   +8 more
doaj   +1 more source