Association of cyclophilins and cardiovascular risk factors in coronary artery disease
Frontiers in Physiology, 2023 Cyclophilins are chaperone proteins that play important roles in signal transduction. Among them, cyclophilins A, B, C, and D were widely associated with inflammation and cardiovascular diseases. Cyclophilins A and C have been proposed as coronary artery
Sandra Gegunde +22 more
doaj +1 more source
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
FEBS Letters, 1994 Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +2 more sources
Extracellular cyclophilins A and C induce dysfunction of pancreatic microendothelial cells
Frontiers in Physiology, 2022 Extracellular cyclophilins (eCyps) A and B are chemotactic mediators in several illnesses in which inflammation plays an important role such as diabetes and cardiovascular diseases.
Rebeca Alvariño +14 more
doaj +1 more source
Delineation of the calcineurin‐interacting region of cyclophilin B [PDF]
Protein Science, 2000 AbstractThe immunosuppressant drug cyclosporin A (CsA) inhibits T‐cell function by blocking the phosphatase activity of calcineurin. This effect is mediated by formation of a complex between the drug and cyclophilin (CyP), which creates a composite surface able to make high‐affinity contacts with calcineurin.
M, Carpentier +4 more
openaire +2 more sources
Overexpression, purification, and characterization of yeast cyclophilins A and B [PDF]
Protein Science, 1992 AbstractTwo isoforms of yeast cyclophilins, yCyPA and yCyPB, have been subcloned, expressed in Escherichia coli, and purified to homogeneity. The full‐length (163‐amino acid) yeast CyPA was easily expressed and purified; however, only a genetically truncated, 186‐residue form of yCyPB lacking a putative 20‐amino acid signal sequence could be purified ...
L D, Zydowsky +4 more
openaire +2 more sources
Genomic and proteomic analysis of Schizaphis graminum reveals cyclophilin proteins are involved in the transmission of cereal yellow dwarf virus. [PDF]
PLoS ONE, 2013 Yellow dwarf viruses cause the most economically important virus diseases of cereal crops worldwide and are transmitted by aphid vectors. The identification of aphid genes and proteins mediating virus transmission is critical to develop agriculturally ...
Cecilia Tamborindeguy +8 more
doaj +1 more source
Inhibition of calcineurin by cyclosporin A‐cyclophilin requires calcineurin B [PDF]
FEBS Letters, 1992 The interaction of the immunosuppressive complex cyclosporin A‐cyclophilin (CsA‐CyP) with the Ca2+/calmodulin‐dependent protein phosphatase calcineurin is investigated using a recombinant form of the A subunit of calcineurin (rCNA). Only in the presence of purified calcineurin B (CNB) does rCNA show the response of native calcineurin, i.e.
Haddy, Alice +3 more
openaire +2 more sources
CypB promotes cell proliferation and metastasis in endometrial carcinoma
BMC Cancer, 2021 Background The molecular pathogenesis of endometrial cancer is not completely understood. CypB upregulated in many cancers, however, its role in endometrial carcinoma has not been studied.
Jing Liu +7 more
doaj +1 more source
The intranuclear prolactin/cyclophilin B complex as a transcriptional inducer [PDF]
Proceedings of the National Academy of Sciences, 2002 The nuclear translocation of peptide hormones, such as the somatolactogenic hormone prolactin, after receptor internalization has been widely reported. Prolactin has been demonstrated to interact with cyclophilin B, a member of the immunophilin family of proteins.
Michael A, Rycyzyn, Charles V, Clevenger
openaire +2 more sources
Synapsin associates with cyclophilin B in an ATP‐ and cyclosporin A‐dependent manner [PDF]
Journal of Neurochemistry, 2005 AbstractImmunophilins are ubiquitous enzymes responsible for proline isomerisation during protein synthesis and for the chaperoning of several membrane proteins. These activities can be blocked by the immunosuppressants cyclosporin A, FK506 and rapamycin.
LANE GUERMONPREZ L. +6 more
openaire +3 more sources