Cyclosporine A-sensitive, cyclophilin B-dependent endoplasmic reticulum-associated degradation. [PDF]
PLoS ONE, 2010 Peptidyl-prolyl cis/trans isomerases (PPIs) catalyze cis/trans isomerization of peptide bonds preceding proline residues. The involvement of PPI family members in protein refolding has been established in test tube experiments.
Riccardo Bernasconi +5 more
doaj +8 more sources
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
FEBS Letters, 1994 Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +3 more sources
Inhibition of calcineurin by cyclosporin A‐cyclophilin requires calcineurin B [PDF]
FEBS Letters, 1992 The interaction of the immunosuppressive complex cyclosporin A‐cyclophilin (CsA‐CyP) with the Ca2+/calmodulin‐dependent protein phosphatase calcineurin is investigated using a recombinant form of the A subunit of calcineurin (rCNA). Only in the presence of purified calcineurin B (CNB) does rCNA show the response of native calcineurin, i.e.
Haddy, Alice +3 more
openaire +3 more sources
BMC Research Notes, 2012 Background Hyperelastosis cutis is an inherited autosomal recessive connective tissue disorder. Affected horses are characterized by hyperextensible skin, scarring, and severe lesions along the back. The disorder is caused by a mutation in cyclophilin B.
Boudko Sergei P +5 more
doaj +2 more sources
Synapsin associates with cyclophilin B in an ATP‐ and cyclosporin A‐dependent manner [PDF]
Journal of Neurochemistry, 2005 AbstractImmunophilins are ubiquitous enzymes responsible for proline isomerisation during protein synthesis and for the chaperoning of several membrane proteins. These activities can be blocked by the immunosuppressants cyclosporin A, FK506 and rapamycin.
LANE GUERMONPREZ L. +6 more
openaire +4 more sources
Elevated Serum Cyclophilin B Levels Are Associated with the Prevalence and Severity of Metabolic Syndrome [PDF]
Frontiers in Endocrinology, 2017 ObjectiveInflammation plays a central role in the pathogenesis of metabolic syndrome (MetS). Cyclophilin B (CypB) can be constitutively secreted in response to inflammatory stimuli and oxidative stress, participating in tissue or systemic inflammation ...
Hang Zhang +16 more
doaj +2 more sources
Cyclophilin B control of lysine post-translational modifications of skin type I collagen. [PDF]
PLoS Genetics, 2019 Covalent intermolecular cross-linking of collagen is essential for tissue stability. Recent studies have demonstrated that cyclophilin B (CypB), an endoplasmic reticulum (ER)-resident peptidyl-prolyl cis-trans isomerase, modulates lysine (Lys ...
Masahiko Terajima +13 more
doaj +2 more sources
Implication of the whitefly Bemisia tabaci Cyclophilin B protein in the transmission of Tomato yellow leaf curl virus [PDF]
Frontiers in Plant Science, 2016 Tomato yellow leaf curl virus (TYLCV) is a single-stranded (ssDNA) begomoviruses that causes severe damage to tomato and several other crops worldwide.
Surapathrudu Kanakala, Murad Ghanim
doaj +2 more sources
Cyclophilin B deficiency enhances myocardial energy synthesis and protects against heart failure in preclinical models [PDF]
BMC MedicineBackground Heart failure (HF) represents the end stage of cardiovascular diseases with high mortality and limited treatment options. Cyclophilin B (CypB), known mainly as an endoplasmic reticulum chaperone, has been implicated in cardiovascular diseases.
Xiao Zong +6 more
doaj +2 more sources
Plant-Mediated Silencing of the Whitefly Bemisia tabaci Cyclophilin B and Heat Shock Protein 70 Impairs Insect Development and Virus Transmission [PDF]
Frontiers in Physiology, 2019 The whitefly B. tabaci is a global pest and transmits extremely important plant viruses especially begomoviruses, that cause substantial crop losses. B.
Surapathrudu Kanakala +3 more
doaj +2 more sources