Results 11 to 20 of about 50,064 (212)
Cyclophilin Succumbs to a Macrocyclic Chameleon [PDF]
Targets that have large and groove-shaped binding sites, such as cyclophilin, are difficult to drug with small molecules. Macrocycles of natural product origin can be ideal starting points for such targets as illustrated by the transformation of sanglifehrin A into an orally bioavailable potential candidate drug.
Bradley C. Doak, Jan Kihlberg
openaire +2 more sources
Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]
Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire +2 more sources
Cyclophilin A in Arrhythmogenic Cardiomyopathy Cardiac Remodeling [PDF]
Arrhythmogenic cardiomyopathy (ACM) is a genetic disorder characterized by the progressive substitution of functional myocardium with noncontractile fibro-fatty tissue contributing to ventricular arrhythmias and sudden cardiac death. Cyclophilin A (CyPA) is a ubiquitous protein involved in several pathological mechanisms, which also characterize ACM (i.
Erica Rurali +10 more
openaire +3 more sources
The Cyclophilin Inhibitor SCY-635 Disrupts Hepatitis C Virus NS5A-Cyclophilin A Complexes [PDF]
ABSTRACT The nonimmunosuppressive cyclophilin (Cyp) inhibitor SCY-635 blocks hepatitis C virus (HCV) replication both in vitro and in vivo and represents a novel potent anti-HCV agent. However, its mechanism of action remains to be fully elucidated.
Sam, Hopkins +5 more
openaire +2 more sources
Cyclophilin A: a key player for human disease [PDF]
AbstractCyclophilin A (CyPA) is a ubiquitously distributed protein belonging to the immunophilin family. CyPA has peptidyl prolyl cis-trans isomerase (PPIase) activity, which regulates protein folding and trafficking. Although CyPA was initially believed to function primarily as an intracellular protein, recent studies have revealed that it can be ...
P. Nigro, G. Pompilio, M. C. Capogrossi
openaire +2 more sources
Bovine mastitis is the inflammatory reaction of the mammary gland and is commonly caused by bacterial infections in high-yielding dairy cows. The detailed investigation of the immunotranscriptomic response of bovine mammary epithelial (BME) cells to ...
Md. Aminul Islam +12 more
doaj +1 more source
Objective To investigate cyclophilin A in early second trimester of pregnancy before the onset of preeclampsia. Methods In this prospective case-control study, 51 pregnant women whose serum were collected and stored and who developed preeclampsia in ...
Samettin Celik, Canan Soyer Çalışkan
doaj +1 more source
Association of cyclophilins and cardiovascular risk factors in coronary artery disease
Cyclophilins are chaperone proteins that play important roles in signal transduction. Among them, cyclophilins A, B, C, and D were widely associated with inflammation and cardiovascular diseases. Cyclophilins A and C have been proposed as coronary artery
Sandra Gegunde +22 more
doaj +1 more source
Cyclophilin A and viral infections
Cyclophilin A (CyPA) is a peptidyl-prolyl cis/trans isomerase originally identified as the target of the immunosuppressive drug cyclosporine A. A number of reports have demonstrated that CyPA plays a critical role in the successful replication of viruses such as human immunodeficiency virus (HIV), hepatitis C virus (HCV), hepatitis B virus (HBV), etc ...
Zhou, Daijun +3 more
openaire +2 more sources
The mitochondrial permeability transition pore is a nonspecific transmembrane channel. Inhibition of mitochondrial permeability transition pore opening has been shown to alleviate mitochondrial swelling, calcium overload, and axonal degeneration ...
Yang Yang +12 more
doaj +1 more source

