Results 21 to 30 of about 45,384 (211)

Association of cyclophilins and cardiovascular risk factors in coronary artery disease

Frontiers in Physiology, 2023
Cyclophilins are chaperone proteins that play important roles in signal transduction. Among them, cyclophilins A, B, C, and D were widely associated with inflammation and cardiovascular diseases. Cyclophilins A and C have been proposed as coronary artery
Sandra Gegunde, Sandra Gegunde, Amparo Alfonso, Amparo Alfonso, Rebeca Alvariño, Rebeca Alvariño, Nadia Pérez-Fuentes, Nadia Pérez-Fuentes, Jeremías Bayón-Lorenzo, Jeremías Bayón-Lorenzo, Eva Alonso, Eva Alonso, Raymundo Ocaranza-Sánchez, Raymundo Ocaranza-Sánchez, Rosa Alba Abellás-Sequeiros, Rosa Alba Abellás-Sequeiros, Melisa Santás-Álvarez, Melisa Santás-Álvarez, Mercedes R. Vieytes, Carlos Juanatey-González, Carlos Juanatey-González, Luis M. Botana, Luis M. Botana   +22 more
doaj   +1 more source

Extracellular cyclophilins A and C induce dysfunction of pancreatic microendothelial cells

Frontiers in Physiology, 2022
Extracellular cyclophilins (eCyps) A and B are chemotactic mediators in several illnesses in which inflammation plays an important role such as diabetes and cardiovascular diseases.
Rebeca Alvariño, Rebeca Alvariño, Amparo Alfonso, Amparo Alfonso, Nadia Pérez-Fuentes, Nadia Pérez-Fuentes, Jesús M. González-Jartín, Jesús M. González-Jartín, Sandra Gegunde, Sandra Gegunde, Sandra Gegunde, Mercedes R. Vieytes, Mercedes R. Vieytes, Luis M. Botana, Luis M. Botana   +14 more
doaj   +1 more source

Cyclophilin‐B is an abundant protein whose conformation is similar to cyclophilin‐A [PDF]

FEBS Letters, 1994
Cyclophilin‐B (bCyP‐20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N‐terminal sequence NH2‐DEKKKGPKVTVK‐VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL.
Galat, Andrzej, Bouet, Françoise
openaire   +2 more sources

Delineation of the calcineurin‐interacting region of cyclophilin B [PDF]

Protein Science, 2000
AbstractThe immunosuppressant drug cyclosporin A (CsA) inhibits T‐cell function by blocking the phosphatase activity of calcineurin. This effect is mediated by formation of a complex between the drug and cyclophilin (CyP), which creates a composite surface able to make high‐affinity contacts with calcineurin.
M, Carpentier, F, Allain, B, Haendler, M C, Slomianny, G, Spik   +4 more
openaire   +2 more sources

Assisted evolution enables HIV-1 to overcome a high trim5α-imposed genetic barrier to rhesus macaque tropism [PDF]

, 2013
Diversification of antiretroviral factors during host evolution has erected formidable barriers to cross-species retrovirus transmission. This phenomenon likely protects humans from infection by many modern retroviruses, but it has also impaired the ...
A Kuroishi, A Lassaux, A Reymond, AM Sheehy, AM Sheehy, B Jia, B Pacheco, B Song, BK Ganser-Pornillos, C Aberham, CA Virgen, CA Virgen, CH Liao, D Blanco-Melo, D Perez-Caballero, D Perez-Caballero, E Battivelli, EE Nakayama, F Zhang, F Zhang, G Brennan, GB Mortuza, GJ Towers, H Yang, HL Wiegand, Jeremy Luban, JW Bainbridge, K Hrecka, KR McCarthy, L Yin, M Pizzato, M Stremlau, M Stremlau, M Stremlau, M Stremlau, M Veillette, MJ Perron, MJ Perron, MR Auerbach, MW McNatt, MW Yap, MW Yap, N Van Damme, O Pornillos, Paul D. Bieniasz, R Mariani, RM Newman, S Cowan, S Ohkura, S Ohkura, S Sebastian, Sam J. Wilson, SB Kutluay, Sebla B. Kutluay, SJ Neil, SJ Rihn, SJ Wilson, SJ Wilson, SJ Wilson, SL Sawyer, Steven J. Soll, SY Lim, T Hatziioannou, T Hatziioannou, T Hatziioannou, T Hatziioannou, T Hatziioannou, Theodora Hatziioannou, V Zennou, X Yu, Y Soneoka, YH Zheng, YJ Zhang, Z Ambrose, Z Keckesova, Z Kratovac   +75 more
core   +7 more sources

Effective Alu repeat based RT-qPCR normalization in cancer cell perturbation experiments [PDF]

, 2013
Background: Measuring messenger RNA (mRNA) levels using the reverse transcription quantitative polymerase chain reaction (RT-qPCR) is common practice in many laboratories.
Beckers, Anneleen, De Brouwer, Sara, Kumps, Candy, Leonelli, Carina, Mestdagh, Pieter, Mets, Evelien, Pattyn, Filip, Rihani, Ali, Rondou, Pieter, Speleman, Franki, Van der Meulen, Joni, Van Maerken, Tom, Van Peer, Gert, Vandesompele, Jo   +13 more
core   +14 more sources

Genomic and proteomic analysis of Schizaphis graminum reveals cyclophilin proteins are involved in the transmission of cereal yellow dwarf virus. [PDF]

PLoS ONE, 2013
Yellow dwarf viruses cause the most economically important virus diseases of cereal crops worldwide and are transmitted by aphid vectors. The identification of aphid genes and proteins mediating virus transmission is critical to develop agriculturally ...
Cecilia Tamborindeguy, Michael S Bereman, Stacy DeBlasio, David Igwe, Dawn M Smith, Frank White, Michael J MacCoss, Stewart M Gray, Michelle Cilia   +8 more
doaj   +1 more source

Inhibition of calcineurin by cyclosporin A‐cyclophilin requires calcineurin B [PDF]

FEBS Letters, 1992
The interaction of the immunosuppressive complex cyclosporin A‐cyclophilin (CsA‐CyP) with the Ca2+/calmodulin‐dependent protein phosphatase calcineurin is investigated using a recombinant form of the A subunit of calcineurin (rCNA). Only in the presence of purified calcineurin B (CNB) does rCNA show the response of native calcineurin, i.e.
Haddy, Alice, Swanson, Selene K.-H., Born, Timothy L., Rusnak, Frank   +3 more
openaire   +2 more sources

Peptidyl-prolyl cis-trans isomerases (immunophilins) and their roles in parasite biochemistry, host-parasite interaction and antiparasitic drug action. [PDF]

, 2006
Immunophilin is the collective name given to the cyclophilin and FK506-binding protein (FKBP) families. As the name suggests, these include the major binding proteins of certain immunosuppressive drugs: cyclophilins for the cyclic peptide cyclosporin A ...
Adams, Aliberti, Alphey, Angus Bell, Antony P. Page, Argaet, Banerjee, Banumathy, Belfiore, Bell, Bell, Bell, Berriman, Blumenthal, Blumenthal, Borel, Bozdech, Braun, Bua, Carlton, Chakraborty, Chakraborty, Chappell, Chappell, Cianciotto, Cohen, Colgan, Dao-Thi, Denkers, Dobson, Dolinski, Dornan, Dornan, Dutta, Fischer, Florens, Galat, Galat, Gavigan, Gavigan, Gilleard, Golding, Hacker, Hall, High, Hirtzlin, Hong, Hope, Kamath, Kay, Ke, Khattab, Kiang, Klinkert, Klinkert, Knobloch, Kumar, Kumar, Kumar, Le Roch, Lightowlers, Lorberg, Ma, Ma, Ma, Matsuda, McLauchlan, Mikol, Monaghan, Monaghan, Moro, Osman, Ostoa-Saloma, Oz, Page, Page, Page, Page, Page, Page, Page, Paul Monaghan, Pelle, Pereira, Peterson, Picken, Pratt, Rascher, Reddy, Riggs, Rossi, Shirane, Silverman, Taylor, Tuo, Valle, Wang, Weiwad, Williams, Yarovinsky, Yu, Zorio   +101 more
core   +1 more source

Cyclophilins A and B oppositely regulate renal tubular epithelial cell phenotype [PDF]

Journal of Molecular Cell Biology, 2020
Abstract Restoration of kidney tubular epithelium following sublethal injury sequentially involves partial epithelial–mesenchymal transition (pEMT), proliferation, and further redifferentiation into specialized tubule epithelial cells (TECs).
Eduard Sarró, Mónica Durán, Ana Rico, Diana Bou-Teen, Vanesa Fernández-Majada, Anthony J Croatt, Karl A Nath, Maria Teresa Salcedo, Justin H Gundelach, Daniel Batlle, Richard J Bram, Anna Meseguer   +11 more
openaire   +4 more sources